SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001009 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001009
Domain Number 1 Region: 1177-1404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-40
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 224-336
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-30
Family Cadherin 0.00061
Further Details:      
 
Domain Number 3 Region: 639-751
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-27
Family Cadherin 0.00067
Further Details:      
 
Domain Number 4 Region: 530-637
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-26
Family Cadherin 0.0019
Further Details:      
 
Domain Number 5 Region: 329-428
Classification Level Classification E-value
Superfamily Cadherin-like 4e-26
Family Cadherin 0.00078
Further Details:      
 
Domain Number 6 Region: 116-222
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 1426-1617
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-26
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 8 Region: 11-114
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-25
Family Cadherin 0.0024
Further Details:      
 
Domain Number 9 Region: 744-846
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 433-534
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 11 Region: 2219-2482
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000128
Family Rhodopsin-like 0.023
Further Details:      
 
Domain Number 12 Region: 1117-1156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000967
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 13 Region: 847-949
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000141
Family Cadherin 0.0097
Further Details:      
 
Domain Number 14 Region: 1757-1797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 15 Region: 1627-1662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000393
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001009
Domain Number - Region: 1668-1703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00028
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1096-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00329
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001009   Gene: ENSTNIG00000010483   Transcript: ENSTNIT00000001848
Sequence length 2725
Comment pep:known_by_projection chromosome:TETRAODON8:19:5861775:5907939:-1 gene:ENSTNIG00000010483 transcript:ENSTNIT00000001848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKRRKRQANTNPQFQLPNYQVSVPENEPKGTRVITVKATDPDDGEAGRLEYSMEAMLDSR
SNAFFEIDLRTGSITTSRPLDREFKDTHVFKVTVTDNGSPKRSATSYLTVTVSDTNDHSP
VFEQNEYRVSIRENVEVGFEVMTIRATDGDAPSNANMVYKIVNDDGVNSVFEIDSRNGLV
RIRERPDRETKDRYQLIVEANDQGKDPGPRSATATVNISVEDENDNYPQFSKKRYVVQVP
ENVAVNTKIIQVEATDQDEGNNAKVHYSIISGNIRGQFYIHSPTGVIDIINPLDYEMIRE
YSLRIKAQDGGRPPLINGTGMVVVQVVDVNDNTPMFVSTPFQATVLENVPVGYSVIHIQA
IDGDSGENARLEYRLIDTTPGFPFTINNSTGWITVSDELDRETMDFYTFGVEARDHGVPA
MSSSASVSTVLDVNDNVPTFTEKVYSLKINEDAIVGTSVLTVTAVDRDVNSVVTYQISSG
NTRNRFAITSQSGGGLITLALPLDYKQERQYVLTITASDGTRYDTAQVFINVTDANTHRP
VFQSANYQVTLSEDRPVGTTVMAISATDEDTGENARITYVMEDNVPQFKIDPDTGTITTQ
MEIDYEDQASFTLAIIAKDNGIPQKSDTAYVEIIILDANDNAPQFLRDMYQGTVLEDAPV
FTSVLQISASDRDSSTNGRVSYTFQGGDDGEGDFIIETYSGIIRIARKLDRENVPVYNLK
AFAVDRGVPPLKAAVPIHVVVQDINDNAPVFEKDVLFIDVEENSPVGSVVARITATDPDE
GSNAQIMYQIVEGNIPEVFQLDIFNGDLVSLTDLDYETRKEYTIVVQATSAPLVSRATVH
IRLVDCNDNPPVLQDFEIIFNNYITNKSNSFPAGIIGKVPARDPDVSDKLHYKFETGNEL
SLLLLNEDTGELRLSKDLDNNRPLEARMTVSVSDGLHHVTVVCTLRVTIITDDMLTNSIT
VRLENMSQERFLSPLLSLFLEGVAAVLSTRREGVFLFNIQNDTDVQGSILNVTFSAMQPG
GSQGKGTFFPSEELQEQIYLNRTLLRLISSQEVLPFDDNICLREPCENYMKCVSVLKFDS
SPPFISSETVLFRPIHPINGLRCRCPLGFTGDYCETEIDLCYSGPCKNNGRCRSREGGYT
CECMDDFTGENCEVNASSGRCIPGVCKNGGVCVNRLAGGFMCECPPGEYEKPYCEMTTRS
FPGQSFITFRGLRQRFHFTVSFMFATRERNALLLYNGRFNQKHDFIAVEIIDEQIQLTFS
GGETRTTVSPYVPGGVSDGQWHSIQLHYYNKPNMGRLGIPHGPSGEKVAVVAVDDCDISM
AVRFGKQIGNYSCAAQGTQTGQKKSLDLTGPLLLGGVPNLPEDFPVSNRDFVGCMKKLSI
DSKPIDMDSHIANNGTTPGCSAKKNFCVKQVCHNGGVCVSKWNTYICDCPTGYGGKNCEQ
VMPSPQFFNGQALVSWSDPDITVAVPWYMGLMFRTRQPAGTLMQANAGLSSTINLMVSEQ
QLRMEVMSRHQLVATLGFPQVRVDDGEWHHLLVELRSVKEGKDIKYMAAVSLDYDMYQKS
VEIGYDLPGLKLQTLYVGGLPAADNHVSKGFVGCIQGVRMGETSTNVANVNMAQGLKIRV
KDGCDVADPCDSNTCPENSHCSDDWSTHTCVCDPGYFGKECTDACQLNPCEHVSTCVRKP
SSSHGYTCECGQNYYGQYCENKVEKPCPHGWWGSPMCGPCSCDTSRGFHKDCNKTSGECR
CKDNHYRPEGEDVCYPCECFSLGSESRTCDAVTGQCPCKGGVIGRQCNRCDNPFAEVTST
GCEDTVVYEGCPKAFDAGIWWPKTRFGRPAATQCPKGSVGTAIRHCSDEKGWLQADLFNC
TTVTFTHLKKMNDELRRNISRMDSEHSKAAVRLLHSATTNMPHYFGNDVRTAAELLNHVL
QYESQQAGFELTAMKDSEFNENLVRAGSSLLDPSNKEHWDQIQRTEGGTAHLLRNFEDYA
NTLAQNVRKTYLKPFTIVTDNMILTVDYLDVTDPEKATLPRFEEISEVYPKELGSYVQFP
QFDLRPQGHKAHPAEPLPTPPTQTDSLQEEVTTVSDRRRRHLEPAAPLPVAVVIVYKSLG
KLLPERYDSDRRSLRLPNRPVINTAIVSTTVHSEGPPLPPVLDPPITLEYTLLETEERTK
PVCVFWNHSLAVGGTGGWSSKGCELLNRNNSHISCQCNHMTSFAVLMDISKREHGDVLPL
KIVTYTTVSVSLFLLLITLILLCLLRRLRSNLHAIHRNLVAALFFSELVFLLGINQTDNV
FVCTVIAILLHYFYMCTFAWMFVEGLHIYRMLTEMRNINHGHIRFYYAIGWGIPAIITGL
AVGLDPQGYGNPDFCWLSVHDTLIWSFAGPIFVVVLVNIVIFVLSAKASCSRRQKAMEKS
GAIPALRMAFLLLLVIGATWLLGLMAVNSNVMLFHYLFAVCSCLQGIFIFFFHVIFNKDV
RKNLKNVFTGKKMVSDESSTTRASLLTRTLNSNNAYEDGTIYRSGIGESTVSLDSTLREE
SGQKSKVSTATAKGHMDLDGPLFQRNSTKGRWFSDDSDSDSELSVDEHSSSYASSQSSDS
EDDDIDAKPKWNNERHPVHSTPKVVDSVSNHVKPYWPAEATTASDSEDLGGAERLRVETK
VNVELHQENKLNHTGERERETQPEREKPASGRDTAPPNQQNSHSNHQPEQRKGILKNKIN
YPPPLSDKNMKNRLREKLSDYNSPT
Download sequence
Identical sequences H3BYE3
ENSTNIP00000013392 99883.ENSTNIP00000001009 ENSTNIP00000001009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]