SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001011 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001011
Domain Number 1 Region: 120-263
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.00000834
Family ADP-ribosylating toxins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001011   Gene: ENSTNIG00000012041   Transcript: ENSTNIT00000003746
Sequence length 506
Comment pep:known_by_projection chromosome:TETRAODON8:18:4985719:4991446:1 gene:ENSTNIG00000012041 transcript:ENSTNIT00000003746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSECDPTENEINEPMLVAGATAQSASECTSSEHLKVFFDRNGLGLGGLANPGVAVRISD
SRESVLTELETDGSGEEALLLPCLAGTSSPPRGVREKRSKRNRHSSSSDRDALASPGTNS
GGFNHFPEDPEFADIIQRAEQAIENGVFPERISQGSSGSYFVKDEKRKIIGVFKPKSEEP
YGHLNPKWTKYFHKLCCPCCFGRGCLLPNQGYLSEAAASLVDTKLGLGVVPKTKVVYLAS
ETFHYSAIDRAKSRGKKYALEKVPKVGRRFHRVGLPPKVGSFQLFVEGYHEADHWLRRFE
AEPLPENTRKQLQSQFERLVVLDYVIRNTDRGNDNWLIKYEKGGTEGREEKDAEWPESCS
ESCIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVAFSQETRDLVLSRLSDMNFVQD
LCEDLYELFKTDKGFDKTMFERQMSVMRGQVLNLTQALKGGKSPIQLVQMPRVVVERRSG
GQGRVVTLSNAFTQTFHCKQPFFSSW
Download sequence
Identical sequences H3BYE5
ENSTNIP00000001011 99883.ENSTNIP00000001011 ENSTNIP00000001011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]