SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001014 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001014
Domain Number 1 Region: 190-356
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-17
Family SPRY domain 0.022
Further Details:      
 
Domain Number 2 Region: 389-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000161
Family Nucleotide and nucleoside kinases 0.032
Further Details:      
 
Domain Number 3 Region: 5-41
Classification Level Classification E-value
Superfamily SAP domain 0.00000154
Family SAP domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001014   Gene: ENSTNIG00000000741   Transcript: ENSTNIT00000001526
Sequence length 576
Comment pep:known_by_projection chromosome:TETRAODON8:1:8367719:8370785:-1 gene:ENSTNIG00000000741 transcript:ENSTNIT00000001526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLDDIKKLKVPELRFKLKELGLEAKGLKAELVTRLWSASEAGKCKDVEENYKEKDTVVT
DGILVIQTIPTDTLDAPPEEAGTSGKMDPGRELSDAATQTETDTDLSHKHSQAVPARGPG
PQAAQRQAGIQQGDEDDCEESGGAQASEERGRGRAFYEFKEEIRYKRQKMNYFAMKVGRQ
INSSFLACTDDSHLHFEMAPDGCGGQPLFWDRFPSLWSGCRLTHGVGQGGVGFEVRVEAL
LTTRLDQKDEEPRQGLRVGWSPPDASLLLGEDDLSFAYDGRGIKVSGGTKEKFGEPFTVG
DIIGCYASFSTDAVEISFQKNGRFMGAAFSLGRPALRGRPLLPHVLCKGCSVSFHLDPAA
PPWYPAPASFAPLVALPAGQLVRAALAPPSHTQCEVLLMVGLPGSGKSHWARTHRKQHPD
KHYRLLGTEELLSCMIVSLLRGSMTSVKQRENQLQQAAQCLTELIKLAAQTPGNYILDQC
NILFSARRYKLQLFAAFRRKVLVVFPSADEWKRRLSEHQPIPETALLKLQLSCRLPEPQS
ELLEELQYLELPGEQAQKLLREYQDQAHRLLPPVPK
Download sequence
Identical sequences H3BYE8
99883.ENSTNIP00000001014 ENSTNIP00000001014 ENSTNIP00000001014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]