SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001015 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001015
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000306
Family Ku80 subunit N-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001015   Gene: ENSTNIG00000005907   Transcript: ENSTNIT00000001069
Sequence length 394
Comment pep:known_by_projection chromosome:TETRAODON8:1_random:623383:629390:-1 gene:ENSTNIG00000005907 transcript:ENSTNIT00000001069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPILLFLLDTSASMNQRTYLGTTFLDVAKGAVEIFMKLRARDPASRGDRYMLVTFDDSPY
GVKAGWKENHATFMCELKNLQASGLTTLGYALRAAFDLLNLNRLVSGIDNYGQGRNPFYL
EPAVIITITDGNKLTHSSGVPDETHTHINYRLCICKSFKKHFKILLFILLCAYRVGHILF
SYSSVLIPLFLFYFFSIFLIYYCVATVGKVQFSHCGINKAGSGQVGMTILSGMPLPHSYP
LDPTGSIIELNPPRSAHPVVRFSCVDCEPMVIDKLPFDKYELEPSPLTQFILERKSPHSC
WQVFVSSSMKQNDLGQPFGYLKASTTLTCVNLFVMPYNYPVLLPLLDDLFKVHKLKPNVK
WRQAFEIYLKTMPPYYLMVNQCFSICLFHYKKCL
Download sequence
Identical sequences H3BYE9
ENSTNIP00000001015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]