SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001033 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000001033
Domain Number - Region: 22-115
Classification Level Classification E-value
Superfamily Tropomyosin 0.0497
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001033   Gene: ENSTNIG00000015781   Transcript: ENSTNIT00000003279
Sequence length 200
Comment pep:novel chromosome:TETRAODON8:1:3856335:3861593:1 gene:ENSTNIG00000015781 transcript:ENSTNIT00000003279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDQEIMCKLENILEIRNKTVQMQKIKSRLKVEFEALESEEKHLKEYKQEMDLLLQEKM
AHVEELRLIHADINVMESTIKQSENDLNKLLETTRRLHDEYKPLKEHVDALRMALGLHRL
PNLNEEEEKLSLESVSIHTHPQRSRDKVTLKSRKRSGRRSPTSLPSQNPSPPQLQLLSSS
RCHGNKTRGRRPPSDSSLHP
Download sequence
Identical sequences H3BYG7
ENSTNIP00000001033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]