SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001037 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000001037
Domain Number - Region: 479-522
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000488
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number - Region: 174-209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00558
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001037   Gene: ENSTNIG00000001625   Transcript: ENSTNIT00000001823
Sequence length 693
Comment pep:known_by_projection chromosome:TETRAODON8:8:5623122:5626195:1 gene:ENSTNIG00000001625 transcript:ENSTNIT00000001823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQQCSTYLEVRDNAPARVSFDCRRPEDVFHVEVTRNIACDTKSCNGRIVQADNGSHPLVR
FDRKFTWNLKASPPKAFQIDFGGAGLRQINMTDRCPDRHRYTLEAFQTTGSVVIGKYCRE
GRIGSAQILNRGSFSVDVPAGETLRRAEFDVRVGEEIKSLAKMTLMLLRGTSSLELLSPN
YPVSFPDDDVMEWYFQLPSKHRAAVQVLRLTEPVCVKKSTALEYQSRARAAVVVRPTAPQ
PEQRQGNFSLTLRNCEMDKKRSASPGLSLGLLVSSSSESFPASCSVDVGALRMDSLRVRK
TSPASHCEMRVNSVLKEDVTLTSKADVSFQDCLPEDVQTTAKATIACRQLRDCPKTPSRL
AVPLLPACFPGPLSNVTWTISPPQQTTVELSGPVGNMRQSLPGQPCNDSVLVKVAEEVGP
IGEFCPQGAIQKLQIHYCNVTVSVSPAEGQTLSEFEMSALITEEISERYIFIVSPKGDTP
VYLASPGWPSGMQDHSTVSWIVSVPEEMEARLMFVNLSRPKCLSSHTYIKVQQIGQEEED
YSRWEDEEADIEIAMLDSFYLNMTNCKPERGILSVVTKISLQNNTRRLLTIMLSVVAALL
VIFTVILVAVCVLNRRKKKKLTHQVSVYNPNGTSVFPGHKPETREDEDHVYASIEDTLVY
THLLRQGKEIGIYGETDTYRPFTGRTEACEQPP
Download sequence
Identical sequences H3BYH1
ENSTNIP00000001037 99883.ENSTNIP00000001037 ENSTNIP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]