SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001048 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000001048
Domain Number - Region: 179-213
Classification Level Classification E-value
Superfamily UBA-like 0.0023
Family CUE domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001048   Gene: ENSTNIG00000012595   Transcript: ENSTNIT00000001149
Sequence length 215
Comment pep:known_by_projection chromosome:TETRAODON8:9:7535083:7541956:-1 gene:ENSTNIG00000012595 transcript:ENSTNIT00000001149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEATETVPVTEQEMQQPQVETGSGTESDSDDSVPELEEQDSTQTQTQQAQLAAAAEID
EEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTY
IVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSSIQENTQTPTVQEESEEEEVDEMGVEVKD
IELVMSQANVSRAKAVRALKNNNNDIVNAIMELTM
Download sequence
Identical sequences H3BYI2
ENSTNIP00000001048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]