SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001107 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001107
Domain Number 1 Region: 43-231
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-44
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 269-328
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000227
Family SAM (sterile alpha motif) domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001107   Gene: ENSTNIG00000016062   Transcript: ENSTNIT00000003787
Sequence length 474
Comment pep:known_by_projection chromosome:TETRAODON8:13:11155643:11166246:-1 gene:ENSTNIG00000016062 transcript:ENSTNIT00000003787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRTFPAGEENEDSGDEWDIGISYEKTSFVQDLDAVASGKDDVMLKRAITNGDTETVRQL
LDKGLDVEMRLDFGWTPMMCAVSVADYNVAELLLERGADASFHKDGWSVLMACITASAQE
DRITRCVELLLSRNADPNVADRSQMTCLMLAAKRGHAKVINLLMVFGAEINAQDSYGYTA
LSIAVQHRRQEAVLKLLQLGADKTIRTNTGKCPADLAAIFKNTEMSKILASSQPISASQA
SSSMENTLSQFFATSGEVSSAKECGRKLDELQLLLHGLDLGSLTDIMAKNDITWSHLLSM
DKEDLEEIGVTDPGDQQKVLDALRQMNLGKVDLETIDRFGGADSGSEELCNFLXXXXXXX
XXXXXTIQDVIGRIPCHPSKIAFALDPEKEAQTLCNQLVIQTGDLQKEVTCLRKLLCQLD
HEECCQPPPPEPCGPWGRQVLSGAALGVLGATCLLVLYGATSGKLNLRVCRNPC
Download sequence
Identical sequences H3BYP1
ENSTNIP00000001107 99883.ENSTNIP00000001107 ENSTNIP00000001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]