SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001133 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001133
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily E set domains 1.05e-23
Family Arrestin/Vps26-like 0.017
Further Details:      
 
Domain Number 2 Region: 152-294
Classification Level Classification E-value
Superfamily E set domains 3.71e-22
Family Arrestin/Vps26-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001133   Gene: ENSTNIG00000000584   Transcript: ENSTNIT00000001628
Sequence length 444
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:24148312:24153567:1 gene:ENSTNIG00000000584 transcript:ENSTNIT00000001628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKVKTFDIFFDHDKTEYSSGDSVSGSVKVELSGPLLCKAIKINCCGFCGVTNKVNDTSW
NVEEQYFNSTISVADKGTLKQGKHVFPFKFLLPASCPTSFEGKYGRIIYRVRAVIDTPRF
VTDYSAEKPFYLLNLLNLNQVPDIWGVSSSAVTKEFSYMLMKSGTVVLKAQTDMKGYTPG
QIIQVKAHISNQSGKSTGHMAASLVQNVSYGTKKPTHDVRTIAEVEGGVVKLGKEVEWKE
QIIVPPLPQSSLAGCELIKVEYYVKVRLKFPDVLLTLPIHIGNVSLDKKLQPSNKAAAAT
APAATAPASTAPASTPDLASSSRTPTGPSEPAVLPRPIPRVRLNPQSLPSAPPAEYHTGA
EGGSPFDQSFPNKRRSQLVSPTAFSYVPGLVFPNNPGGFVTPSSVSSAPYPTDGASSTPI
PPPRYSTASSPQEAPPSYDESCST
Download sequence
Identical sequences H3BYR7
ENSTNIP00000001133 99883.ENSTNIP00000001133 ENSTNIP00000001133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]