SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001134 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001134
Domain Number 1 Region: 80-158
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-26
Family Intermediate filament protein, coiled coil region 0.0000253
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001134
Domain Number - Region: 31-76
Classification Level Classification E-value
Superfamily Prefoldin 0.0034
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001134   Gene: ENSTNIG00000000710   Transcript: ENSTNIT00000003170
Sequence length 223
Comment pep:known_by_projection chromosome:TETRAODON8:2:15357165:15359315:-1 gene:ENSTNIG00000000710 transcript:ENSTNIT00000003170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQETQVQIQMDMSKPDLTAALRDIRMQYEGIAAKNISEAEEWYKSKVSDLNQAVNKNNDA
LRQAKQETMEYRHQIQSYTCEIDSLKGTNESLLRQMRDMEDRMGREASGYQDTIGRLEAD
IAKMKDDMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITTTVPLQSAYSSIGFRE
TSPESQPHRGSEVHSKKTVLIKTIETRDGEVVSESTQHQQDSM
Download sequence
Identical sequences H3BYR8
ENSTNIP00000001134 ENSTNIP00000001134 99883.ENSTNIP00000001134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]