SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001139 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001139
Domain Number 1 Region: 563-680
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-30
Family Cadherin 0.00098
Further Details:      
 
Domain Number 2 Region: 232-353
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-29
Family Cadherin 0.00082
Further Details:      
 
Domain Number 3 Region: 465-567
Classification Level Classification E-value
Superfamily Cadherin-like 4e-28
Family Cadherin 0.00046
Further Details:      
 
Domain Number 4 Region: 672-775
Classification Level Classification E-value
Superfamily Cadherin-like 6.04e-21
Family Cadherin 0.0041
Further Details:      
 
Domain Number 5 Region: 128-237
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 345-463
Classification Level Classification E-value
Superfamily Cadherin-like 6e-16
Family Cadherin 0.0059
Further Details:      
 
Domain Number 7 Region: 25-93
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000785
Family Cadherin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001139   Gene: ENSTNIG00000006929   Transcript: ENSTNIT00000001174
Sequence length 1015
Comment pep:known_by_projection chromosome:TETRAODON8:20:1107319:1111307:-1 gene:ENSTNIG00000006929 transcript:ENSTNIT00000001174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDAVDCLFCSVLVLQLLHQPAAKQVLRYRLAEEGPADVRVGNVAADLGIVAVSGEVTFTL
ESGSEFFKIDNITGELSTNERRIDREKLQQCQMIFDENECFIDFEVSVIGPAQSWVDLFE
GKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQESSV
FELQVADTTDGEKLPQLIIKGALDREQRDSYLTLRVRDGGDPPRSSQAILRVMITDVNDN
SPRFEKSVYEADLPENSPPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDEST
GWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIF
LKDGTANVAEDVVVDTPIALVQVSDRDQGQNGVVTCTVVGDVPFQLKPASEMEGEQNKKK
YFLHTSAPLDYEATQEYNVVIVAVDSGSPSLASNNSLLVKVGDTNDNPPIFGQNVVEVSF
PENNGPGERVTTVTAIDADSGKNAEIAYSLDSSVNGIFSIDADTGDIRVNAVLDREHTER
YEFRVIAKDKGVNTLQGSATVVVLVSDKNDNEPKFMQDVFTFYVKENLEPNSPVGMVTVI
DADKGHNAEMSLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSA
TATVSLFVMDENDNAPTVTFPKNSSYTLLPPSSNIRTLVRKVVATDTDTGINADLNYSII
GGNPFKLFDIDGGTGVILLMGKLEQKHYGLHRLVVQVNDSGQPSQSTTTLVHVYVNETLS
NSTVVEAQVAKSLSTSLNTNIAGDPNYDLSKQRLSIAIGVISGIMTVILIILVVVMARYC
RPKNKNGYEAGKKDHEDFFTPQQHDKSKKPKKDKKKQKSKQPLYSSIVTVEASKPNGQRY
DGVSEKLSDSPGMGRYRSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGKKHQAVQDL
PPANTFVGTGDNISLGSDHCSEYSSQTINKYNKQIPSHQYFCLFTSSFSCLVSIY
Download sequence
Identical sequences H3BYS3
ENSTNIP00000001139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]