SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001202 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001202
Domain Number 1 Region: 248-384
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.00015
Further Details:      
 
Domain Number 2 Region: 473-600
Classification Level Classification E-value
Superfamily Cadherin-like 5e-23
Family Cadherin 0.00039
Further Details:      
 
Domain Number 3 Region: 366-478
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-20
Family Cadherin 0.0000822
Further Details:      
 
Domain Number 4 Region: 158-252
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000537
Family Cadherin 0.00011
Further Details:      
 
Domain Number 5 Region: 31-171
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000194
Family Cadherin 0.0034
Further Details:      
 
Domain Number 6 Region: 586-685
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000654
Family Cadherin 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001202   Gene: ENSTNIG00000003590   Transcript: ENSTNIT00000003935
Sequence length 876
Comment pep:novel chromosome:TETRAODON8:Un_random:28823886:28833716:-1 gene:ENSTNIG00000003590 transcript:ENSTNIT00000003935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLFIRRFSGEIVFLKLLSVSWEFVTPEEQTCVPGFKQSTFILKVTSKHLRQQVSLGKVN
FEDCTDRTRFSFSSSDGRVRAQADGALTVKRPITLHEGHLDFLIHIWDSRGRKHTLPVRL
LHQERQREAGMEAQVPVVYFHKSGEGLKRRKRDMVIPPLNVPENHRGPYPLKISQIRSNK
DDTTRIYYSISGPGANQPPVNLFTMDRVSGTLFVTQQLDREQQASYMLKAYAVAEGSGTA
EEPMDIIVNVIDQNDNKPAFVKDTFLGEVPEASPTNFEVIQVNATDLDEPNSYNSDIRYK
ILSQEPKLPSDNLFTINPTTGVIRVNAGGLDREKYPEYTLEVQAADLEGIGLTGVAKVIL
TVTDSNDNAPAFTQASYETSVAENKADSQILRMLVTDGDEPHSAAWNAKFTIVSGDPGGF
FSVKTGTNKQEGILSTAKGLDFEKNSKHTLLIAVENEVPFAVALPTATATVVVTVQDVNE
APIFDPPEKQVSKGEDLPVGTDVVQYTASDPDTARKQKVMYRILNDPAGWLNVDKETGVI
KVKTSMDRESLFVKDNKYTALIGAYDDDEVPATGTGTLMVLLEDVNDNAPVIEERAFQVC
RNKPAPQLLSVTDKDGPGNGAPFSVSLQDPSRSNWTARMNDSIETGIILQLTKALESGQY
TVVLRVADNRGRDQDNTVQATVCECTGEDNQCQERVAAGTNLPVILGVLAGILLLLMLVL
LLLMFARRRRGPQKEPLLQDTDTRDNIFYYDEEGGGEDDQDYDLSVLHRGLDNRPEVFRN
DVMPNFMPAPQYQPRPANPEEIGNFIDNNLKTADNDPTAPPYDSLLVFDYEGGGSDSGSL
SSLNSSSSGDQDYDCLSQWGPRFKKLADMYGGGEDD
Download sequence
Identical sequences H3BYY6
ENSTNIP00000001202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]