SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001217 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001217
Domain Number 1 Region: 410-536
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 207-309
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 98-205
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-23
Family Cadherin 0.0052
Further Details:      
 
Domain Number 4 Region: 311-414
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-21
Family Cadherin 0.0085
Further Details:      
 
Domain Number 5 Region: 526-635
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-16
Family Cadherin 0.0064
Further Details:      
 
Domain Number 6 Region: 2-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000186
Family Cadherin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001217   Gene: ENSTNIG00000004211   Transcript: ENSTNIT00000002529
Sequence length 775
Comment pep:novel chromosome:TETRAODON8:1:6699691:6705254:1 gene:ENSTNIG00000004211 transcript:ENSTNIT00000002529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIRYSIPEEMTKGMFVGDVAKDLGLDVKLVSGRARLVLDSNSQYVALNPNKGHVVVNERI
DRETLCAKKSPCSFSLEIVLLENPMELHPVTIEVLDVNDNAPTFQNNHLEFEISESAALG
SRFVLESAYDADVGANGLQSYILTPNHHFVLKQHVRRDGSKYSEMMIEKPLDREAQPRLS
LKLLAVDGGNPQRSGTVNIDVNILDVNDNAPVFNQSLYKTIVTENAPTGTLILTVNASDI
DSGSNGKVTYSFSKTKAGVTDVFDIDGDTGRIYVAKEIDFEKDKRIEFRIEAKDQGLTDS
AKVEVEVLDENDNAPVINVMSFSNPVSEDSAVGATIGIINIKDLDSGENGQVRCTVEGNV
PFKVKSNVRNYYALITDAALDRETLSECNITIIALDGGSPPLQTRRTLFVKITDVNDNAP
AFSSASYKALLIENNSPGASVLSVNARDPDENQNARVSYFLEDSEIGGSPVSEYVTVNAE
SGAIHAVRSFDYEQIKQLVFMVRAQDGGSPPLSSNVSVRILIQDQNDNPPQVLYPVQTGG
SMVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYKLQKATDRALFEVGLQNGEIRTVRQ
VSDKDAVKQRLSVIVEDNGQPSRSATVVVNVAVADSFPEVLSEFTDFAQDKEYNDNLTFY
LVLALAVVSFLFITCLVVIVSVKIYRWRQSRILYHSSLPVIPYYPPRYSDTLGTGTLQHV
YNYEVCRTTDSRKSDCKLGRAASQNVLIMEPSSTGTMQRIQSDKSILDEPDSPLE
Download sequence
Identical sequences H3BZ01
ENSTNIP00000001332 99883.ENSTNIP00000001217 ENSTNIP00000001217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]