SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001219 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001219
Domain Number 1 Region: 159-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-39
Family SPRY domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001219   Gene: ENSTNIG00000000690   Transcript: ENSTNIT00000002604
Sequence length 290
Comment pep:novel chromosome:TETRAODON8:Un_random:46139145:46140369:1 gene:ENSTNIG00000000690 transcript:ENSTNIT00000002604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEEFQRMIQERLSKVEEIQNRLQLSAVFPQQASAAEDLENCDRLFESLIRSVEERRGDVR
AEIRSRQKEAERRAESLIGQLQRETAELQRRTAGLEELLDTEDHLHLLQGVEHTPPDGPS
SLGALGPAQRARPALRGNARRALSEVEETLAKEMDALKMRRMQKYAGDVVLDPDTAHPNI
LLSADGKRAGRGEPLQTVPDHPKRFDPVICVVARTGFLSGRFYFQVEVGAKTFWDLGVVR
ESAGRKGMITSTPENGFWTVRLRSGEEYRALDSPSVLLTLPKRPRVIGVF
Download sequence
Identical sequences H3BZ03
99883.ENSTNIP00000001219 ENSTNIP00000001219 ENSTNIP00000001219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]