SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001274 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001274
Domain Number 1 Region: 200-406
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.11e-37
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 2 Region: 432-608
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-24
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number 3 Region: 1206-1469
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000384
Family Rhodopsin-like 0.023
Further Details:      
 
Domain Number 4 Region: 748-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000879
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 5 Region: 618-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 656-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000055
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001274
Domain Number - Region: 127-218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0105
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001274   Gene: ENSTNIG00000010483   Transcript: ENSTNIT00000002230
Sequence length 1797
Comment pep:known_by_projection chromosome:TETRAODON8:19:5857534:5887184:-1 gene:ENSTNIG00000010483 transcript:ENSTNIT00000002230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLHHVTVVCTLRVTIITDDMLTNSITVRLENMSQERFLSPLLSLFLEGVAAVLSTRREGV
FLFNIQNDTDVQGSILNVTFSAMQPGGSQGKGTFFPSEELQEQIYLNRTLLRLISSQEVL
PFDDNICLREPCENYMKCVSVLKFDSSPPFISSETVLFRPIHPINGLRCRCRENCEVNAS
SGRCIPGVCKNGGVCVNRLAGGFMCECPPGEYEKPYCEMTTRSFPGQSFITFRGLRQRFH
FTVSFMFATRERNALLLYNGRFNQKHDFIAVEIIDEQIQLTFSGGETRTTVSPYVPGGVS
DGQWHSIQLHYYNKPNMGRLGIPHGPSGEKVAVVAVDDCDISMAVRFGKQIGNYSCAAQG
TQTGQKKSLDLTGPLLLGGVPNLPEDFPVSNRDFVGCMKKLSIDSCSAKKNFCVKQVCHN
GGVCVSKWNTYICDCPTGYGGKNCEQVMPSPQFFNGQALVSWSDPDITVAVPWYMGLMFR
TRQPAGTLMQANAGLSSTINLMLVATLGFPQVRVDDGEWHHLLVELRSVKEGKDIKYMAA
VSLDYDMYQKSVEIGYDLPGLKLQTLYVGGLPAADNHVSKGFVGCIQGVRMGETSTNVAN
VNMAQGLKIRVKDGCDVADPCDSNTCPENSHCSDDWSTHTCVCDPGYFGKECTDACQLNP
CEHVSTCVRKPSSSHGYTCECGQNYYGQYCENKVEKPCPHGWWGSPMCGPCSCDTSRGFH
KDCNKTSGECRCKDNHYRPEGEDVCYPCECFSLGSESRTCDAVTGQCPCKGGVIGRQCNR
CDNPFAEVTSTGCEDTVVYEGCPKAFDAGIWWPKTRFGRPAATQCPKGSVGTAIRHCSDE
KGWLQADLFNCTTVTFTHLKKMNDELRRNISRMDSEHSKAAVRLLHSATTNMPHYFGNDV
RTAAELLNHVLQYESQQAGFELTAMKDSEFNENLVRAGSSLLDPSNKEHWDQIQRTEGGT
AHLLRNFEDYANTLAQNVRKTYLKPFTIVTDNMILTVDYLDVTDPEKATLPRFEEISEVY
PKELGSYVQFPQFDLRPQGHKEPLPTPPTQTDSLQEEVTTVSDRRRRHLEPAAPLPVAVV
IVYKSLGKLLPERYDSDRRSLRLPNRPVINTAIVSTTVHSEGPPLPPVLDPPITLEYTLL
ETEERTKPVCVFWNHSLAVGGTGGWSSKGCELLNRNNSHISCQCNHMTSFAVLMDISKRE
HGDVLPLKIVTYTTVSVSLFLLLITLILLCLLRRLRSNLHAIHRNLVAALFFSELVFLLG
INQTDNVFVCTVIAILLHYFYMCTFAWMFVEGLHIYRMLTEMRNINHGHIRFYYAIGWGI
PAIITGLAVGLDPQGYGNPDFCWLSVHDTLIWSFAGPIFVVVLVNIVIFVLSAKASCSRR
QKAMEKSGAIPALRMAFLLLLVIGATWLLGLMAVNSNVMLFHYLFAVCSCLQGIFIFFFH
VIFNKDVRKNLKNVFTGKKMVSDESSTTRASLLTRTLNSNNAYEDGTIYRSGIGESTVSL
DSTLRSAKSRNSYLAYALREESGQKSKVSTATAKGHMDLDGPLFQRNSTKFSDDSDSDSE
LSVDEHSSSYASSQSSDSEDDDIDAKPKWNNERHPVHSTPKGMQMFPTLVDSVSNHVKPY
WPAEATTASDSEDLGGAERLRVETKVNVELHQENKLNHTGERERETQPEREKPASGRDTA
PPNQQNSHSNHQPEQRKGILKNKINYPPPLSDKNMKNRLREKLSDYNSPTITSPPPNNNT
SSSHPPSSVNIISPSWIPPVAIYRETNGGMAMHLKSGTVNGGNESDSEFPPLPPLQT
Download sequence
Identical sequences H3BZ58
ENSTNIP00000001274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]