SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001291 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001291
Domain Number 1 Region: 373-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-48
Family SPRY domain 0.00069
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 1.26e-18
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 141-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000366
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001291   Gene: ENSTNIG00000001084   Transcript: ENSTNIT00000004168
Sequence length 544
Comment pep:known_by_projection chromosome:TETRAODON8:3:4011004:4015387:1 gene:ENSTNIG00000001084 transcript:ENSTNIT00000004168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRMSTKLWTDEQFNCPVCLDLPNDPVTIPCGHSYCMGCIKDFWSKDEPKGIYSCPQCRQV
FCPMPSLSRNTMLAEAVEQLRKGALKADTSKGKLSSSAVACDMCKGKQNAAVKSCLVCMS
SYCEAHLKPHQTKKALKQHELIPPTSNLAEKICTQHKYLQEFFCRQCQTFICWLCTSNQH
KGHESVSTKVERLEKQKVLSELQTETHQRLKDREQELKDLKKVMDVMKRSAGKVHSETER
TLTELQRSVERLQELMEEVLDQANLEKMSQAQEVADSLEAEIKVLRKRDTEMRDLAQCED
HIHYLQTCESMSGPLETGALPTVAVNQEASFEPVLDAVLDLRERVEDMCNQELGKITKEI
NIDSFQAPEPRSREEFLQYAIALTLDPNTAHRRLAISEGDTKATLQGAAQPYLDTPERFD
GWTQVMCQGPMYAQRCYWEVEWRGRGSSIGVAYGAVSRKGSDARSGLGYNARSWTLELSD
TCCAAMHDNQKRDIPVTYSPRLGVYLDLSSGTLAFYSVADSMTHLHTFHANFTQPLYAAF
GVGT
Download sequence
Identical sequences H3BZ75
ENSTNIP00000001291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]