SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001303 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001303
Domain Number 1 Region: 31-521
Classification Level Classification E-value
Superfamily Sema domain 1.57e-169
Family Sema domain 0.00000000021
Further Details:      
 
Domain Number 2 Region: 517-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000102
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 584-664
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000567
Family V set domains (antibody variable domain-like) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001303   Gene: ENSTNIG00000011399   Transcript: ENSTNIT00000002639
Sequence length 734
Comment pep:known_by_projection chromosome:TETRAODON8:19:1787918:1799147:1 gene:ENSTNIG00000011399 transcript:ENSTNIT00000002639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGPQGWAVPLALLALSLLCVGVASLPPPRPRVFLSFEDLQASGWLQTSSVSERPMDYRI
LHVDEDQERMFVGCRDHVLSLDINNVTQGAQKLFWPASAAKIQECQMAGKDPTHGCGNFV
RVVQPYNRTHLFVCGSGAYSPVCVYVNRGRRPEERVFHVDSKAESGKGRCSFNPGVNTVA
VMLNQELFSGVYIDFMGTDAAVFRSLTRRNAVRTDQHNSKWLSEPAFVAAHLIPDGSHPN
DSKLYFFLRERLADSGGATQSVRTTVARVCPNDVGGQRSLVNRWTTFLKARLVCSVPEAD
GTETHFDQLESVFLLESERPEAPLLFGVFASTSSVFTGSAVCVYKMADVLTVFNGPFAHR
EGPGFRWGAFQGRIPYPRPGTCPGGAFTPDLQSTKQLPDEVVAFARNHPLMFNPAYPLGR
RPLLVRAGAPYRYTAVAVDQVAAADGSYQVLFLGTDEGRVQKVIVLPGNDSLHQDLILEE
LEVFQNKAPVTNLWISSKKQQLYVSSEWGLSQVSLHRCQAYGSACADCCLARDPYCAWDG
RSCSRFYPAAKRRSRRQDVMHGNALTQCRGFNLKVAYRNAAETTQYGVRNNTTFLECFPT
SPQASVRWLIQRDDDRRKEVKLSERVVSTPLGLLIRGARPSDQGLYSCLSTENGFRRTAA
KIHLRLLGSTEDLLEALSPVESLAVQQYCQERAELRKLQQRAALVAPGPLRGDLAKLKPL
LDRRRSRHRRHPAP
Download sequence
Identical sequences H3BZ87
ENSTNIP00000014344 ENSTNIP00000001303 99883.ENSTNIP00000001303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]