SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001304 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001304
Domain Number 1 Region: 73-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-82
Family Protein kinases, catalytic subunit 0.00000248
Further Details:      
 
Domain Number 2 Region: 964-1030
Classification Level Classification E-value
Superfamily G protein-binding domain 1.05e-23
Family RhoA-binding domain 0.00042
Further Details:      
 
Domain Number 3 Region: 1139-1227,1311-1338
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000104
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 1246-1308
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000014
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001304
Domain Number - Region: 432-534
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000126
Family Myosin rod fragments 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001304   Gene: ENSTNIG00000008471   Transcript: ENSTNIT00000001339
Sequence length 1374
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:1352446:1371255:-1 gene:ENSTNIG00000008471 transcript:ENSTNIT00000001339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGESMDVRFEKIDAMLTDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
ETINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKFTSKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSSWVVQLFFAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPGKWARFYTA
EVVLALDGIHSMGFIHRDVKPDNMLLDKTGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVVGDTPFYADSLVGTYSKIMNHKNALTF
PDDSDISNDAKNLICAFLTDREVRLGRNGLDEIKRHPFFKNDQWTWENIRDTAAPVVPEL
SSDIDTSNFDDIEEDRGEEETFPVPKAFVGNQLPFVGFTYYSNQHYIPVRKASTASKTSD
KRGSSTKEDKSHLENLQKRIYQLEEQLHSEMQLKDELEQKCRSSHTKLEKIMKELDEEAN
IRKNAESSVSLLEKDKIMLQHRFTEYQRKADQEAEKRRNLENEVSTLKEQLEDMRKISQN
SQASNDKIIQLQNQLEEANDLLRAESDTAARLRKNHTEMAKSMSQLESLNRELQERSRAI
DSEKAQLEKEVLLIQSTLDSERRNYSQGSEEIRELQARMAGLQEDNKSLKLSLSKVEAER
KQAQERSNNLEKEKNNLEIDLNYKLKTLQQRLEQEQTEHRVTRAQLTDKYESIEEAKSAA
MNAVQQKTSEEIGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKSL
RIQGEQDLSKRALAQSELKSRMQEVDRLRCSEKQLKQEINTALESKRSLEFQLAQLTNDF
PGNNRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRQVQETHKRVQDLSSER
HRDSLSAQLDLTVTKAESEQLARALQEEQYFELSQENKKAGARHKQEIMEKDAIISRLEE
SNKTLTKDAENLSKEKTELNDKLQAQEQEFLAQKEEISNTIKANYEKTLNTERTLKTQAV
NKLAEIMNRKDMKLDHKKKGSTADLRRKEKENRKLQQELNLEKEKFNHMAIKYQKELSEM
QAQLSEEFVNRNELQMQLDSKESDIEQLREKLNDLQQRMDNSSITSLQADETDSNIAESR
LEGWLSIPNRVNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVT
QGDVYRAETEEIPRIFQILYANEGECRKEADMEPVLQGDKTNCFPHKGHEFIPTLYHFPS
NCEACSKPLWHVFKPPPALECRRCHVKCHKDHLDKKEDVIAPCKVNYDVTSARDMLLLAL
TQDEQKKWIGHLGKKIPKTPPTTFSRASPRAMSTRTGPNQSFRKNPKSNTGKLR
Download sequence
Identical sequences H3BZ88
99883.ENSTNIP00000001304 ENSTNIP00000001304 ENSTNIP00000001304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]