SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001322 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001322
Domain Number 1 Region: 386-591
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6.72e-48
Family ATP-dependent DNA ligase catalytic domain 0.00023
Further Details:      
 
Domain Number 2 Region: 601-744
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.08e-35
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0002
Further Details:      
 
Domain Number 3 Region: 7-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.84e-29
Family PARP-type zinc finger 0.0000105
Further Details:      
 
Domain Number 4 Region: 838-918
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000727
Family DNA ligase 0.00047
Further Details:      
 
Domain Number 5 Region: 165-399
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000000000628
Family ATP-dependent DNA ligase DNA-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001322   Gene: ENSTNIG00000010270   Transcript: ENSTNIT00000003011
Sequence length 919
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27326683:27331737:-1 gene:ENSTNIG00000010270 transcript:ENSTNIT00000003011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSQADMAEQRFLVEYAKRGTAGCKKCKDKIVKGIVRIGKIVPNPFSESAGEMKEWYHVKC
IFEKLERARATTKKIEDLTELEGWEELQDEDKNLIKEHISELMAKVNASPKKKVQAKLNT
SGHLMAPPADPSVNAPRKFSGFTGKQQHLHPLMSSSTPGSSLSSQLCNPQHKDCLFREFR
KLCATVAENNSYNAKTQIIEQFLRKGSGGDKFHGDLYLTIKLLLPGVIKSVYNLNDKQIV
KLFSRIFRCNQEEMVRDLEQGDVSETVRVFFDNSKSFPPASKSLLTIQEVDASLTRLAQL
TKEDEQQSELESIAKKCTSNDLKCIVRLVKHDLKMNAGAKHVLDAVDPNAYDAFKASRNL
GDVIDRVLRNQQEASNGSGPRKLLTVEATLMTPVQPMLAEACKSVEYAMKKCPNGMYSEI
KYDGERVQVHKNGDSFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDAEVLLIDTQ
TSKPLPFGTLGIHKKAAFQDANVCLFVFDCIYFNGTSLMERPLCERRKFLHDNMVEVPNR
ILFSEMKHVTRAADLADMITRVIREGLEGLVLKDVKGMYEPGKRHWLKVKKDYLNEGAMA
DTADLVVLGAFYGKGSNGGIMSSFLMGCFDPDSKKWCTVTKCSGGYDDAMLARLQKELDV
VKISKDPSKIPQWLKIVKNYYPDFIIRNPEEAPVWEITGAEFSKSEMHTADGISIRFPRM
TRIRDDKDWKSATNLHQLKELFRISKENCDFKVTTGTSDNDKASSGESGGHSPPASSRGG
AVPKRKSTEGPTKAKAVKSQPRNPGPEAPSAKKVKKSENVHSNGKTNEVKSEVKSVEPKK
DQTLLDIFSGVKLFLPLTVQDFDKLRRYFVAYDGELVPEYDAAAATHTMAEPEDDSGAQR
VTPSWIWECIRKRRVVPPC
Download sequence
Identical sequences H3BZA6
ENSTNIP00000001322 ENSTNIP00000001322 99883.ENSTNIP00000001322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]