SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001332 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001332
Domain Number 1 Region: 434-560
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 121-228
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-24
Family Cadherin 0.0054
Further Details:      
 
Domain Number 3 Region: 230-341
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 334-438
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-22
Family Cadherin 0.0041
Further Details:      
 
Domain Number 5 Region: 550-659
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-16
Family Cadherin 0.0064
Further Details:      
 
Domain Number 6 Region: 27-119
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000006
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001332   Gene: ENSTNIG00000004211   Transcript: ENSTNIT00000001884
Sequence length 758
Comment pep:novel chromosome:TETRAODON8:1:6699610:6705131:1 gene:ENSTNIG00000004211 transcript:ENSTNIT00000001884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILRTKYNPLDCTFFFLLCAVATIKGQIRYSIPEEMTKGMFVGDVAKDLGLDVKSRARL
VLDSNSQYVALNPNKGHVVVNERIDRETLCAKKSPCSFSLEIVIEDPLELFSVTIEIQDV
NDHAPTFQKKEIILNISEATPTGTIFLLDSAVDPDVGINSLQSYALKTNDHFVLKQHTRS
DGSKYAEILLQTMLDREKQSKHDLILTAVDGGEPQRSGTVKIHINVLDANDNAPVFTQPT
YKVAVLENILRDTIITKVSAVDADQGYNGNVTYYFTHLEEESSCPFQINSYTGEVKLTGD
VDYETSPIYEINLQAKDPWGFTGASELIIDIVDVNDNSPVITMASFSGPVSEDSAVGATI
GIINIKDLDSGENGQVRCTVEGNVPFKVKSNVRNYYALITDAALDRETLSECNITIIALD
GGSPPLQTRRTLFVKITDVNDNAPAFSSASYKALLIENNSPGASVLSVNARDPDENQNAR
VSYFLEDSEIGGSPVSEYVTVNAESGAIHAVRSFDYEQIKQLVFMVRAQDGGSPPLSSNV
SVRILIQDQNDNPPQVLYPVQTGGSMVAEMVPRSADVGYLVTKVVAVDVDSGQNAWLSYK
LQKATDRALFEVGLQNGEIRTVRQVSDKDAVKQRLSVIVEDNGQPSRSATVVVNVAVADS
FPEVLSEFTDFAQDKEYNDNLTFYLVLALAVVSFLFITCLVVIVSVKIYRWRQSRILYHS
SLPVIPYYPPRYSDTLGTGTLQHVYNYEVCRTTDSRKS
Download sequence
Identical sequences H3BZB6
ENSTNIP00000001332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]