SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001341 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001341
Domain Number 1 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-36
Family Second domain of FERM 0.000000878
Further Details:      
 
Domain Number 2 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2.92e-26
Family Third domain of FERM 0.0000099
Further Details:      
 
Domain Number 3 Region: 80-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000385
Family First domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001341   Gene: ENSTNIG00000008388   Transcript: ENSTNIT00000001833
Sequence length 405
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:74565064:74568692:1 gene:ENSTNIG00000008388 transcript:ENSTNIT00000001833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKIGVGNVVKAMQFEPSTMVYDACRIIRERVPEAQMGQPNDYGLFLSDEDPKKGI
WLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIG
ITNYDEYSLVRDMGEEKKEETTGTLRKDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
YQCQIQFGDHNESKHKSGFLDLKEFLPKEYIKNKGEKRIFQAHKNCQNMTEIEAKVSYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKVKS
Download sequence
Identical sequences H3BZC5
ENSTNIP00000001341 99883.ENSTNIP00000001341 ENSTNIP00000001341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]