SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001350 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001350
Domain Number 1 Region: 1807-2053
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.58e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 813-946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000502
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 3 Region: 397-528
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000102
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 243-413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000011
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 585-714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 711-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000225
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 7 Region: 1073-1186
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 978-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000073
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 9 Region: 211-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000572
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 557-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000709
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 96-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000896
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 12 Region: 523-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000196
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 13 Region: 748-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 14 Region: 173-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000365
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 15 Region: 131-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000046
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 16 Region: 941-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000561
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 17 Region: 1195-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000102
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 788-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000116
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 58-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000125
Family EGF-type module 0.028
Further Details:      
 
Domain Number 20 Region: 1351-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family EGF-type module 0.015
Further Details:      
 
Domain Number 21 Region: 1017-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000411
Family EGF-type module 0.021
Further Details:      
 
Domain Number 22 Region: 1269-1313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000439
Family EGF-type module 0.012
Further Details:      
 
Domain Number 23 Region: 1490-1522
Classification Level Classification E-value
Superfamily Notch domain 0.000000222
Family Notch domain 0.0037
Further Details:      
 
Domain Number 24 Region: 1410-1441
Classification Level Classification E-value
Superfamily Notch domain 0.000000327
Family Notch domain 0.00046
Further Details:      
 
Domain Number 25 Region: 1450-1483
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.0054
Further Details:      
 
Domain Number 26 Region: 15-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000008
Family EGF-type module 0.011
Further Details:      
 
Domain Number 27 Region: 1311-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000183
Family EGF-type module 0.019
Further Details:      
 
Domain Number 28 Region: 1228-1272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001350   Gene: ENSTNIG00000007203   Transcript: ENSTNIT00000001335
Sequence length 2400
Comment pep:known_by_projection chromosome:TETRAODON8:4:7172912:7185694:1 gene:ENSTNIG00000007203 transcript:ENSTNIT00000001335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPSDFVGNRCQYPSPCSPSPCRNGGECRAVSHGNTFDFRCVCRLGFTDRLCLTPTNHAC
MSSPCRNGGTCELITLTAYRCRCPPGWSGKTCQIANPCASNPCANGGQCSAFDSTYICTC
PPAFHGQTCKQDVNECAQTPSPCLNGGVCVNEVGSYHCRCPSEYTGQHCETAYMPCSPSP
CQNGGTCIQKGDTTFNCICLPGFTGEHCEHNIDDCPGHSCQNGGVCVDGVNTYNCQCPPH
YTGQYCTENVDECELMPNACQNGGTCHDTHGSYHCVCVNGWMGDDCSENIDDCASAACYH
GATCHDRVASFFCECPHGRTGLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTG
SACNLDIDECSLDVVGANPCEHGGRCINTKGSFQCKCLQGYEGPRCEMDVNECMSNPCHN
DATCLDQIGGFHCICMPGYEGVFCHINIDECASQPCLNNGKCVDKINSFHCECPKGFSGN
LCQVDIDECASTPCKNGAKCTDGPNKYTCECAEGYTGQHCEIDINECYSDPCHYGTCKDG
LASFTCFCRPGYTGRLCETNINECLSQPCKNGGTCQDRENTYVCICPKGTAGFNCEVNLD
DCKSKPCDYGRCIDKINGYECACEPGYTGAMCNININDCAINPCHNGGTCVDGINSFTCL
CPEGYNDATCLSQVDECRSNPCIHGRCQDLINGYKCACDSGWSGPNCDINNNECESNPCM
NGGTCKDMTSGYHCTCRVGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLENIG
ENCETLLAPCSPRPCKNGGVCKEAEDYQSFSCICPEGWQGQTCEIDINECVKNPCHNAAV
CHNTMGGYQCQCQPGYTGLKCEIDTDDCKPNPCSNGGLCLDGVNSFTCTCPPGFRGGRCE
QDINECESNPCKNGANCTDCVNSYTCTCPLGFSGINCEINTNDCTDSSCFNGGTCVDGIN
AFTCLCLPGFTGSYCQYDINECDSKPCLNGGTCLDSYGTYKCTCPLGYTGVNCQNLVRWC
DSSPCKNGGSCWQQGASYTCQCQTGWTGLYCDIPSVSCEVAAKQQGIDVAHLCRNSGQCL
DAGSTHYCRCQAGYTGSYCQEQVDECSPNPCQNGATCTDYLGGYSCECVPGYHGINCSKE
INECQSQPCQNGGTCIDLVNTYKCSCPRGTQGPSEGVHCEINLDDCTPFTDPLTNEPKCF
NNGKCVDRIGGYQCMCLPGYVGERCEGDVNECLSDPCDPRGSYNCIQLTNSYRCECRTGY
TGQRCDKVFDGCKGRPCRNGGTCAVASNTPHGFICKCPPGFTGSSCEYNSRSCGALNCRN
GGTCVSGHLGPRCLCPATFTGPECQTPTDSLCISNPCYNGGTCQITPDVPFFRCSCPSNF
NGLLCHILDYSFVGGFGRDITPPPEVEVSCEIPQCDEWAGNHICDSLCNNHACGWDGGDC
SLNFDDPWQNCSAALQCWRYFNDGKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDH
YADGHCDQGCNNAECEWDGLDCANNMPEKLADGHLVLVVHIPPEQLKNRSSAFLRELSSV
LHTNVVFRRDAKGEPMVFPYYGNEQDLVKHNVLKRSADGWPDWASMPADVLGQSVVYLEI
DNRQCYQQSTECFQSATDVAAFLGALASSGNLNVPYIEAVTSVRPTSPGSELYPMYIVFL
GLAALGFICLGVLVSRKRKREHGQLWFPEGFKVSEPSKKKRREPLGEDSVGLRPMKNSDI
NLMDDNQIEWDDEDPDCRRLRLEEQAMLDLCDHGDPRKWTQQHLDAADLRIACIAPTPPQ
GEIENDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDPSAEIITDFIYQGANLHNQ
TDRTGETALHLAARYARSDAAKRLLESSADANVQDNMGRTPLHSAVAADAQGVFQILIRN
RATDLDARMHDGTTPLILAARLAVDGMVEELINCHADVNATDDSGKSALHWASAVNNVEA
AVVLLKNGANKDMQDNKEETPLFLAAREGSYQTAKVLLEHFANREITDHLDQLPRDIAQE
RMHHDIVRLLDEYNVVRSPGLHNAPLNTSSLSPPLASPNDYLSNLKPSMSVKKVRKLTSG
GKGGKDGGKDGRNKKKKSVDGKGNLLDTSAVLSPVESLESPHGYLSDVASPPMASPFQQS
PPISLNHLQGTGDLLGMNAGKDVGCMSFDPNPPRLSHLPVSSPHSQGAASLGGSRGGQCD
WVSRMHPGVSQQGNFTQAPTMTHNIMSALHGVTTATLSQIMGYQNLQTSHLGSPAHMIQQ
AHSQQLQHQNTNSNPAAGPPLNQSCPNIELNGSEMQQSNSSGHVMTIHTVMPQETQILGT
QFLTPPSQHSYSGPMDNTPNHQLQVPDHPFLTPSPGSPDQWSSSSPHSNMSDWSEGISSP
Download sequence
Identical sequences H3BZD4
ENSTNIP00000001350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]