SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001351 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001351
Domain Number 1 Region: 164-274
Classification Level Classification E-value
Superfamily C-type lectin-like 8.1e-37
Family Link domain 0.0024
Further Details:      
 
Domain Number 2 Region: 272-359
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-26
Family Link domain 0.0019
Further Details:      
 
Domain Number 3 Region: 58-163
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000884
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001351   Gene: ENSTNIG00000009540   Transcript: ENSTNIT00000003726
Sequence length 362
Comment pep:known_by_projection chromosome:TETRAODON8:5:10231294:10232722:-1 gene:ENSTNIG00000009540 transcript:ENSTNIT00000003726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLTCYHQCVLLLGAQLVVSGWALTAQNNFFYHSYLKGNGSKEIHFSGLRLHVDASRPSV
VVARGDNATIPCRFWYEPELTAPREVRVKWTWQAGAGGLETEVLVATGSRTRSSEGFGGR
VHLRQDFPGDAALMMTAVMVNETGRYRCEVVDGLEDKSVSVDLELYGVVFPYQHSRGRYR
LSFLGAQQACEEQGATLATLAQLLQSWKEGLNWCNVGWLADGTVRYPITRPRVACGGPRL
PPGIRSYGRRHPNLHRYDVFCFFSSLGGKVFFLQQSEGMNQTEARRSCQESGADVAKVGQ
LYAAWKFAGLDRCDAGWLADGSVRYPITAPRPNCGPSEPGVRSFGFPPPQLKYGVYCYQS
EE
Download sequence
Identical sequences H3BZD5
ENSTNIP00000001351 99883.ENSTNIP00000001351 ENSTNIP00000001351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]