SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001360 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001360
Domain Number 1 Region: 833-1104
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000496
Further Details:      
 
Domain Number 2 Region: 1101-1401
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000149
Further Details:      
 
Domain Number 3 Region: 3-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-28
Family MAM domain 0.0000233
Further Details:      
 
Domain Number 4 Region: 357-562
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-26
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 5 Region: 253-392
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000369
Family Fibronectin type III 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001360
Domain Number - Region: 190-260
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0602
Family I set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001360   Gene: ENSTNIG00000003833   Transcript: ENSTNIT00000003191
Sequence length 1404
Comment pep:known_by_projection chromosome:TETRAODON8:21:5724881:5744369:-1 gene:ENSTNIG00000003833 transcript:ENSTNIT00000003191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGCTFDQDSEPGSCDYRQGQDDDLDWQLIRTYSWPHPSPDLLPGSFMMVNSSQHLAGQR
AQLLLQPLSENDTHCIQFSYFLFSRDGHSPGELQLYVRVNGGPKGSAVWNTSGSQGRQWH
QVELAVSTFWPSEYQETSEPAEGDRRSGDTHLASGLSLSPEHLFPRSSALGAGEGATWAK
MAPMFVPAQVFLRWKRNGVLLDAPALSRLSHKRLMAAFQVEAQRGEQDLYRCVTLSPRGA
AVSNFGELIVRVPPTPIAPPQLLRAGPTYLIIQLNTNSIVGDGPVIRREVRYRASPSTWT
ETHGVGSLTYKVWHLEPDTQYHISVLLTRPGDGGTGAPGPPLISRTKCAEPMRALRGLTA
TDIQPRQLSLRWEPLGYNLTRCHTYTLSLCYRYSVPTGGGGTNNATVRECLSVERNTSRF
TLRDLPPFHAVHVRLALANPEGKKESREVTFQTEEDVPGGISSESLSFTPLDDMVFLKWE
EPVEPNGLITQYEISYQSIESSDPGINVPGPRRTVSKLRNETYHMFSGLHPGTTYLVSVR
ARTAKGFGQSALTEITTNISAPVFDYEDVPSPLSETESTITVLLRPALARGAPVSAYQVV
VVEEDGSRQVRRREVGSGDCFPASPAAAGRGAPHYYTAELAPSSLPEATPFTVGDNHTYN
GYWNSPLDPTRSYLIYFQATSNFKGETRINCIRIARKAACKDAKRALEVSQHAEDMGLIL
AACVGAPLVLVLLLGALVGVLKKGKKVTLPKASMSYRQEKSRKLSSIDGGLVEAGPLQLD
RRLAPAFMDAHGCASRNEQRSSVTESSSLLGGSPQRRCRRRSSPFHTGQLHPAVRVADLL
QHINQMKTAEGYGFKQEYQSFFDGWDVSKKKDKTKGRHDSLLSHDRQRPRLPSLLADPCS
DYANANYIDGYQRSNHFIATQGPKQEMVYDFWRMVWQENCFSIVMITKLLEVGRMKCCKY
WPDDSELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVRQFHFTSWPEHGVPRHAT
GLLAFLRRVKASTPPDAGPVVVHCSVGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLC
SRRINMIQTEEQYVFIHDAILEACLCGETAIPVSEFALTYKEMLKVDSQSNTSSLREEFQ
TLNSVTPHLDVEECSISLLPRNREKNRSMDVLPPDRSLAFLVAADGESSSYINAALADSF
LRPAAFVVTPHPLPSTTSDFWRLVYDYGCTSVVMLNQLNQSNSAWPCLQYWPEPGLQQLG
PVTVELLSRTADDDVIIRLFRVQNITRLQEGPLLVRHFQFLRWSPYRDVPDSRKAFLLLA
QVHGWQRECGEGRTAVHCLNGGGRSGTFCACTMILEMIRHHSVADAFFAAKTLRNAKPNM
VETMEQYRFCYDLAQEYLECLEVR
Download sequence
Identical sequences H3BZE4
ENSTNIP00000001360 99883.ENSTNIP00000001360 ENSTNIP00000001360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]