SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001373 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001373
Domain Number 1 Region: 232-352
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-20
Family Cadherin 0.0055
Further Details:      
 
Domain Number 2 Region: 120-216
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000714
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 56-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000034
Family Cadherin 0.0093
Further Details:      
 
Domain Number 4 Region: 338-437
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000769
Family Cadherin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001373   Gene: ENSTNIG00000001687   Transcript: ENSTNIT00000003198
Sequence length 539
Comment pep:known_by_projection chromosome:TETRAODON8:8:7550626:7554285:-1 gene:ENSTNIG00000001687 transcript:ENSTNIT00000003198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGIKSQPGCIFALLHDAFHNFAGLGDGLSLEGEAVWWDSCWSTTRTRSRRSTPQLTYA
IVRQLPDTSQKTFSIDAASGEIQVLRVLQRKELKLYELTVNASDPDFSTECKVLIKVIDV
NNEVPVFEKTDYGSHTVAEDTPVGHTLLTVMATDNDEPDSGSSIIQFHISSGNQDGYFAV
ETNGTGVGHVVVAKPLDFEASPTLRLQIDARNPEPLMKGLDYGDESSTFVLVSLTDVDEA
PEFSLDLVDVAVPENITQGSVLLTAEAKDPEGKEISFKLDGDTQDWLEIDASTGEIKTKA
KLDRETLETFEVKVTAFEKNNPKMSAESVVNVRLLDVNDNVPRLVEKEVFICARKPEPVI
LTATDGDDPPFAQPFTFVLGSGKKSPNWDLSSVDGSTAKLTLKKIPTEEITVTLPVNIKD
HAGMGVTHALSVRVCNCTALGYCYTAPASRGHMGPGATAIILVGVLLFCGKRAAPARCRR
PSRAALALTPLRVPPQVSFSSWSLDRLRKGTRRRPTRRERRRRGSSCRDADTRTRVEPD
Download sequence
Identical sequences H3BZF7
ENSTNIP00000001373 ENSTNIP00000001373 99883.ENSTNIP00000001373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]