SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001374 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001374
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-44
Family C-type lectin domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001374   Gene: ENSTNIG00000001276   Transcript: ENSTNIT00000002354
Sequence length 149
Comment pep:novel chromosome:TETRAODON8:Un_random:12832313:12833113:1 gene:ENSTNIG00000001276 transcript:ENSTNIT00000002354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLVFHLFKAKPCPKCPDGWQEFEGQCYYFSDNKLKWEEARERCQQQGADLVQVSSKEEQ
QFLTDRVKPMMSDNDDLFWIGLTDSVTEDTWLWVNGSSLDERLKFWAIDEPNNYLDGEDC
VRMGNTGGNINSWSDRACGHSEKSICEKP
Download sequence
Identical sequences H3BZF8
99883.ENSTNIP00000001374 ENSTNIP00000001374 ENSTNIP00000001374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]