SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001376 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001376
Domain Number 1 Region: 149-431,514-632
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.94e-70
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0019
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily UBA-like 2.65e-16
Family UBA domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001376   Gene: ENSTNIG00000018679   Transcript: ENSTNIT00000002431
Sequence length 1030
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27508743:27516891:-1 gene:ENSTNIG00000018679 transcript:ENSTNIT00000002431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LINQLKEITGIQDPQLLLSALNASQGDVGQAVGLLTSQPLEVRDPGDPQESKSTDETWRA
QKGAKPFLETFQKMLSSVITVVGLPKDELQTAIELSLQESHNAQQEEKDLNRVLEASAEE
NLARMKRMKRSEGQGDMSSPADWIRQDDWPVGIRNVGNTCWFSAVIQSLFHLPVFRRLVL
NYRLSERILEKCKSHSDKRNIAFMQELRCLFALMVGSTRRFVDPSAAVELLRDAFRTSEA
QQSFQDVSEFSHKLLDWLEDAFQLAANGSHAADKQQNPMVQLFYGTFVTERKLEGKTLCN
IEQFGQYPLQVNGFNNLYECLEGAMVEKEIESLHSDHSVASGRERWFEKLPPVLTFELSR
FEFNTQLGRPEKIHKKLEFPQVIFMDRYLHKNIKQTHERRGEVKKLKEELAALQQKLECY
RNYGSGPTKYPLADMLQFVLEFATTKPTNGSTAEDPRPSSPSPSLTGQPVGEAVCQDSRD
TDPPEALVSSCQRTPIYKPFTQCRPPIECPPHPAPHSISEEELHFVKTCLQRWRAEVEND
INELKANMDRLGQMLESMYSDNRLCQVPYRLHAVLVHEGQASAGHYWAYIYDHANQRWMK
YNDINISESSWEELERDSFGGLTNASAYCLMYIDDRLPDLITDDTDDETGQVLHGLDSLP
SVLRRYVGEDNRWFQQELSEWEEQISPQEHLEVTVATPPERSPSPQPEDSSSAAAVQPSQ
RSAVELHTQGVILAIAKARQTFDHQGPEAGLIKAFHEEYSRLYELSQEETTPQEDPRLQH
VLVYFFQNKAPKRIIERTLLEQFTDRNLSFDERAVSIMREARSKLRLIKPEDMDMDEYLQ
WHDDYKLFRTVFVYLLTGLEHYQNQKMREALTYLAHAGEINSSLLEKGETFAVDQTVITV
FRRKCLTALNESATQLFCSGNDASVDEGVAIMDEVVIPCLHLMSRDPALSQEDQEAMEGV
RSHWCSCLSRSMDDLLQVKLGEFLPRVLDSSADSVVLKDPPQVHVNQAHDLCSRLAAVME
SIHKSSVVIV
Download sequence
Identical sequences H3BZG0
ENSTNIP00000001376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]