SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001443 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001443
Domain Number 1 Region: 22-239
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-55
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 723-829
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000173
Family Myosin rod fragments 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001443
Domain Number - Region: 1198-1357
Classification Level Classification E-value
Superfamily Tropomyosin 0.00111
Family Tropomyosin 0.0077
Further Details:      
 
Domain Number - Region: 422-515
Classification Level Classification E-value
Superfamily Tropomyosin 0.00589
Family Tropomyosin 0.0095
Further Details:      
 
Domain Number - Region: 619-715
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0732
Family Myosin rod fragments 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001443   Gene: ENSTNIG00000009552   Transcript: ENSTNIT00000003692
Sequence length 1397
Comment pep:known_by_projection chromosome:TETRAODON8:5:10400338:10411897:1 gene:ENSTNIG00000009552 transcript:ENSTNIT00000003692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCNSCCCSYPCQNTDWNKYDDRLMKAVERGEVDKVAAVLSKKGVVPTKLDVEGRSAFH
LAATRGHLDCLNLILAHNVDVTATDASGKNALHLSSRNGHSQCVQKLLQHNCPVGNVDLQ
GRIALHDAVMAGCSSSVKLLCDSGAAVNATDFDGRTPLVLATQMCHPRICQLLLERGADI
TIRDKQNKTALILGCEYGCKDAVEVLLKSGADVKAVDSLGHDAFHYARLSKNTELVALVK
THLDKITRDKETAKMEQWKHQNNLYQQSVERFESLESNRRDQIIHDLERQNETLQESLKK
YHQEQRALIDKVNLLQQQLTQEKLTVEGAQKEKEQLKGLLVAKDGEEGARGSETVKVQLR
STLGDYSGQSVIKGKENVLVKQAHSLDSDHVSLTHFYPNFEQIVQKLSVSRPGDKSQPTV
GWDVSGELNTLRQEHEAVKRKQHAAEEEVARLQSALNRKNRECQELVQSRDAIQKQADQQ
IHELEEALGDVQKRMLDSECKVKQLQAHVVAVKEHLGGQGVEDLRLQLQDVKAKYEGASA
EVGRVRNRLKQSEKALEEYKSSESQLAAEAERLGQDLDVVVAERDELAEVLVVMEAKLKE
ADTKHGSMVPAEKFDNMKNLLTNAVDEKERQLAELREDYDRVLEEVADLNRKMDGPPSQT
SAEEQQRLRASLEGQNDSLKQKLLELTAKSQDLICEVKEGKEERSILLEQLNEFRTRIEM
DFIPIRDYEEARKSMVMALEELEDKLVEASERYGKAEAQVQQLQAERTQLQENISSIQSS
SKTHQSQLDELSSHNCDLLKKIELMQRQSEDGKKERVQLNARIQTLEKSLAAEYVPRQQH
ENVKAELGSALESARAETLQTQKEKKASEEELTKVKDGNDRLKEELEKLSQEMKDDRIHV
KEHKDATEKLKATVAEAETKVKEVTALYLSAQEETVKLTQELEAQKKELDTIQQAIQSKF
ISVAAAEEKQKAHLVQVADLQNKLAEMEAEYTKEKCAGQSNKQEQEKLKVEMESVQQRLD
SALVTSERHRDVEEEFKSRCDQLTHKLSSLEQQHQELLLQKADLHEQNALCRTQNQNLQD
RLKAELTRIATYDSELKALHDAMQQAQTDCKKAREARQEEAQKVGALQKELQEQRRDQAS
LLQQQAQSEERLEAEMAEISRLRLALREEEENSAQRAEDVSALQSELLQATQALEKVRYK
EEQMNQMKKEKQELEKEVTDLSSKLLGVADQCKEAQQEAARAREKESKVRAEMESIQEKG
NTIEGEIGELKKRYDESLSTIGDLQRRIQTSAQQTEAKDKKITELLTDVERLKQALSGLS
QLAYTSNTPSKRQAQHTDAMQAQIRSLQQQLADAERQHREVVSIYRTHLLSAAQGHMDED
VQAALLQIIRMRQELVC
Download sequence
Identical sequences H3BZM7
99883.ENSTNIP00000001443 ENSTNIP00000001443 ENSTNIP00000001443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]