SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001447 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001447
Domain Number 1 Region: 505-663
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-44
Family MAM domain 0.00072
Further Details:      
 
Domain Number 2 Region: 160-328
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-25
Family MAM domain 0.0047
Further Details:      
 
Domain Number 3 Region: 338-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-24
Family MAM domain 0.004
Further Details:      
 
Domain Number 4 Region: 19-161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.69e-17
Family MAM domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001447   Gene: ENSTNIG00000018658   Transcript: ENSTNIT00000000662
Sequence length 687
Comment pep:known_by_projection chromosome:TETRAODON8:4:9855635:9864538:-1 gene:ENSTNIG00000018658 transcript:ENSTNIT00000000662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLFFSLTEAIAQAQSQLLPGSCNFESSTCGYTSDGEFTSWNLHKDGIRVLCDTTGYKAG
RKQEITGTLVSPVLEYSEWSCLRLVYQIMGSGSLKVLQRTEGKSFDKPLWSGQTPSDSWV
ITSMDLKNNTESYKIIIEGKPGQSAGSSVAIFEIHIVPGYCLECDFEESHLCGYSNQWNA
NVNWYVGGGRTQLLHNNIPNDHTFNNKTGHLMYVDSVYAKTFKEVAKLVSPMTTVPLSGC
LSFQYQRSDERGNIFSVFTRDHMGQYQELWRAGAQNESDWSGTLSEWIPVQVDLKAPYSI
QVVFEVAFNSPSGGRVAVDDISFSPQFCNKDNEPPFDPATASCNFEAGLCHYTLDNVAGS
SWRRVLVKRNIFQNGDHTTGTAGSFLLAHSQSRHSGYISRLIGQTLPGNMKYCLRFFYSL
SAGFNQTHSALMVYVQQQQSGTQEKIWTQGEKSRGIWIAADVTFQISQPAKLVFISSCRD
IWDCNSVALDDISLNLGDCNLATVLPGHCDFEAGLCDYSQDKQDDGADWEWRRGPTPTSY
TGPRGDHSTGLGYYLYMEASATLPGQSIRLLSRPLRGFRGSQCLQFYYHMYGSGTGELNL
HLKYDSGEKLLWQQSGEQSISWLRATVEFQHDSQHQIVFEATRGASVRSDIAIDDIVLEG
GPCQDPGITSTVETSNKRKENRIYIQF
Download sequence
Identical sequences H3BZN1
99883.ENSTNIP00000001447 ENSTNIP00000001447 ENSTNIP00000001447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]