SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001476 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001476
Domain Number 1 Region: 92-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000016
Family EGF-type module 0.007
Further Details:      
 
Domain Number 2 Region: 159-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 3 Region: 128-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000912
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 4 Region: 47-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000025
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 4-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000056
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001476
Domain Number - Region: 213-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000697
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001476   Gene: ENSTNIG00000001191   Transcript: ENSTNIT00000003168
Sequence length 238
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:58891670:58895425:-1 gene:ENSTNIG00000001191 transcript:ENSTNIT00000003168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GELCEVNMDECESQPCENGGWCEDGRASYSCHCPQEQQGPELGCRKRDWCEGDPCLGQGR
CIDLWTSYRCDCYRPFYGHNCSHGTLGCTGAPVCSSEPCLNGGACEDQFDQFSCACLPGW
GGERCQSDLDDCASQPCAHGSCRDLLAGFQCVCQPGFTGRLCSEDVDDCEDHACEHGGTC
QDGVDGYTCACPEDYRGPRCQWRHPPERCGLHVTCANEGVCADGLWGANCTCAPGFTG
Download sequence
Identical sequences H3BZR0
ENSTNIP00000001476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]