SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001489 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001489
Domain Number 1 Region: 117-225
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-38
Family Link domain 0.0041
Further Details:      
 
Domain Number 2 Region: 230-312
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-23
Family Link domain 0.0022
Further Details:      
 
Domain Number 3 Region: 11-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000987
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001489   Gene: ENSTNIG00000000655   Transcript: ENSTNIT00000002307
Sequence length 314
Comment pep:known_by_projection chromosome:TETRAODON8:12:2575679:2576839:1 gene:ENSTNIG00000000655 transcript:ENSTNIT00000002307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQQISLHVSSFPVRIFSEPGGNATLPCRLLSKRHNPGVQVRWTKLENDEAPLEDVLLWL
GTRSKTFGRFENRVFLQAADDRDASLVITDIATEDIGQYRCEVSDGMKHTAEEGFLKRSG
VVFPYSPPSGRYNLNFTNATQACLEQDAVIASHNQLIKAWRGGLDWCNAGWLRDGSVRYP
ITKPREPCGGADNPAGLRSYGLQDRRSLFDVFCFASALKGTFYWLVQPDRLTFAEAVQAC
LDDGAEIAKVGHIFAAWKLEGYDRCDAGWLADGSVRYPISRPRNNCSPTEAAVRFVGFPD
KRHKFYGVYCYKAQ
Download sequence
Identical sequences H3BZS3
ENSTNIP00000001489 ENSTNIP00000001489 99883.ENSTNIP00000001489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]