SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001525 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001525
Domain Number 1 Region: 2294-2367
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.1e-19
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 2 Region: 2086-2218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 1721-1852
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-17
Family Growth factor receptor domain 0.0067
Further Details:      
 
Domain Number 4 Region: 273-340
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-17
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 5 Region: 671-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 2409-2536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-17
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 7 Region: 404-533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.04e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 907-975
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-16
Family TB module/8-cys domain 0.00073
Further Details:      
 
Domain Number 9 Region: 984-1118
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.16e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 1192-1332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 804-888
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.62e-16
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 12 Region: 1642-1708
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.62e-16
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 13 Region: 1483-1555
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.42e-16
Family TB module/8-cys domain 0.0000456
Further Details:      
 
Domain Number 14 Region: 612-685
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000012
Family TB module/8-cys domain 0.00086
Further Details:      
 
Domain Number 15 Region: 2012-2105
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000196
Family TB module/8-cys domain 0.0003
Further Details:      
 
Domain Number 16 Region: 127-212
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000589
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 17 Region: 1806-1930
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000753
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 18 Region: 1360-1492
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 2535-2650
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 20 Region: 2180-2302
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 21 Region: 536-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000847
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 22 Region: 1561-1616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.00051
Further Details:      
 
Domain Number 23 Region: 2365-2414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000234
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 24 Region: 1112-1167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000247
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 25 Region: 168-284
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 26 Region: 1964-2011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 27 Region: 1324-1362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.032
Further Details:      
 
Domain Number 28 Region: 1923-1966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000503
Family EGF-type module 0.006
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001525
Domain Number - Region: 1157-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000629
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 98-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 65-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0361
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001525   Gene: ENSTNIG00000015528   Transcript: ENSTNIT00000001247
Sequence length 2830
Comment pep:known_by_projection chromosome:TETRAODON8:1:16229217:16255293:1 gene:ENSTNIG00000015528 transcript:ENSTNIT00000001247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQLSPSCGSGA
ASTVQSCNIRCMNGGSCAEDSCTCPKGYTGSHCGQPVCENGCQNGGRCIGPNRCACVYGF
TGPQCERDYRTGPCFTQVSHQMCQGQLSGIICTKTLCCATIGRAWGHPCEQCPAQPHPCR
RGFIPNIRTGACQDVDECQAVPGLCAGGNCINTVGSYECKCPAGHRQSDTSHKCEDIDEC
STIPGVCDGGECTNTAGSYVCSCPRGYISSTDGSRCVDQRVGTCFSALANGRCAAELNGQ
YTKMQCCCDTGRCWALGQIPEMCPVRGSEEFRRLCIVGVPQGHGIPNVYPNGNGGGFGGN
GGGFGGNGGGFGGNGGGFGGNGGGGAGGGGNLPIDSGSASVNESIDVCKHFTNLCLNGRC
IPIHASYRCECNMGYKQDVRGECIDVDECVSNPCINGDCVNTPGSYHCKCHEGYQGTPTK
QACIDIDECIVNGVMCRNGRCVNTEGSFQCICNAGFELTPDGKNCIASPAQDHDECATTN
MCLNGMCINEDGSFKCICKPGFALAPNGRYCTDIDECQTPGICMNGRCINSEGSFRCECP
PGLAIGMDGRVCVDTHMRTTCYGAIKMGTCSRPFPGAVTKSECCCADPEHGFGEPCYPCP
SRNSAEFQALCNSGIGITADGRDINECALDPDICLNGICENLRGSYRCICNIGYESDTSG
KSCVDINECLVNRLLCDNGLCRNTPGSYTCSCPKGFIFKPDSETCEDINECLSSPCVNGV
CRNVAGSFNCECSLGSKLDSTNTICVDSMKSTCWLTIQDSRCEVNINGATLKSECCSTLG
AAWGSPCEPCEIDTSCSRGFARMKGLVCEDINECEVFPGVCTNGHCVNTQGSFRCECAEG
LTLDSTGRTCVDLRSEQCYLKWHEDECGEPLPGRYRVDMCCCTVGAAWGVDCEECPPGSP
EFRAICPRGNGFANRGDILTGRPFYKDVNECKVFQSLCTYGNCRNTIGSFKCRCNSGFAL
TAEERNCTDIDECRISPDLCGPGTCVNTPGSFECECFEGYESGFMMMKNCMDIDECERNP
ALCHGGTCLNTEGSYECECPTGHSLSADGSSCEDVNECQLSENLCKNGQCVNMAGTFQCS
CDTGYQATPDRQSCVDIDECTIMNGGCETHCTNSEGSYECSCSEYALMPDLRTCADIDEC
EETPDICDGGQCTNIPGEYRCLCYDGFMASMDMRTCIDVNECDLNPNICLHGDCENTKGS
FICHCQLGYFVNKGSTGCTDVDECEIGAHNCAMHAACINVPGSFKCRCRDGWVGDGIECL
DQDECAGEDHNCNLNADCLNTPGSYRCACKDGFVGDGFSCSDMDECADNVNLCENGQCLN
APGGYRCECEMGFTPTEDSRACQDIDECNFQNICVFGSCQNLPGMFRCVCDDGYELDRSG
GNCTDINECADPMNCINGLCVNTPGGYMCNCPEDFELNPTRVGCVDTRVGNCFLDTNIRG
DGGISCSLEIGVGVTRASCCCSLGGAWGNPCELCPPSNSSEYKTLCPGGEGFRPNPITVI
LEDIDECQELPGLCQGGICINTFGSFQCECPAGYYLNEETRVCDDIDECVSSIGICGPGT
CYNTQGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKMVCCCSYNV
GKAWNKPCEACPAPASSDYRVLCGNQAPGFIIDIHTGKPIDIDECRDIPGLCAHGVCINQ
IGSFRCECPMGFSYNNILLICEVDIDECSSGDNLCQRNANCINIPGSYRCQCSPGFKLSP
NGACVDRNECQEIPNVCSHGSCIDTQGSYRCACHNGFKATADQSMCMDIDECDRQPCGNG
TCKNTVGSYNCLCFPGFELTHNNDCMDIDECSALQGQVCRNGQCINGLGFFQCFCHEGYE
NTPDEKNCVDVNECVRLPGTCSPGTCQNLDGSFRCICPPGYEVQNDQCIDINECEVESNT
CQFGTCTNTPGSFQCTCQPGFVLSDNKRRCYADTRESFCFTKFDAGKCSVPKALNTTKAK
CCCSKMPGEGWGLPCELCPRSNEVSSGLQNSMSYGLGSVIGPLNREDTNECLDNPGVCQN
GICINTDGSFRCECTFGYNLDYTGVKCVDTDECSIGNPCGNGTCTNVVGGFECLCQEGFE
PGPMMTCEDVNECSQNPLLCAFRCVNTFGSYECMCPDGYVLRDDQRMCRDQDECSEGLDD
CDSKGMTCKNLIGTFMCICPPGMQRRPDGEGCTDLNECRAKPGICSNGRCVNTVGSYRCE
CNDGFEPSATGTECIDNRQGYCYTEVLQTMCQQSSTSRISVTKSECCCNVGRGWGSQCEL
CPLPGTVHFKKMCPLGPGYTTDGRDINECQVLPDLCRNGQCVNTIGSFRCHCNVGYKADF
TSTSCVDLDECALSPKPCNFLCKNTEGSYLCSCPRGYSLQPDGKTCRDVDECSTKQHNCQ
FHCVNTIGGFTCKCPTGFTQHQTACIDNNECAGPNSGCGSRASCVNTPGSFSCECSKGFS
LDSSGMECEADVDECSNNHRCQHGCQNMLGGYRCGCPQGYVQHYQWNQCVDENECQGGSC
RSASCYNTLGSFKCVCPSGFDFDQTAGGCQDVNECSAGGNPCIYGCSNTDGGYLCGCPGG
FYRAGQGHCMSGSGFTGQFTEGDEEDSLSPEACYECKINGGGKNGRHKRSAGENGLKQAR
EAQEQHSAVSMASVDTQDAIPMNVSLSSLLNKEPLLELLPALQPLENHVRYVITHGNANE
HFRLLERRDGKSVLRLGKRPPLPGSYRLEIASLRLFGPRRLHQLERQHDNDYLQGEIGDA
LRIKLNIHVH
Download sequence
Identical sequences H3BZV9
ENSTNIP00000001525 99883.ENSTNIP00000001525 ENSTNIP00000001525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]