SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001551 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001551
Domain Number 1 Region: 60-240
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000000798
Family RUN domain 0.0063
Further Details:      
 
Domain Number 2 Region: 373-393,422-475
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000184
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001551   Gene: ENSTNIG00000018317   Transcript: ENSTNIT00000003614
Sequence length 477
Comment pep:known_by_projection chromosome:TETRAODON8:8:8208113:8211701:1 gene:ENSTNIG00000018317 transcript:ENSTNIT00000003614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPIPPSAPPLPPKLHQVPLRSPVRSASFAGSVPKADSPWMGEDAKHPLRGTGLSSLCLRE
KKVLVGAVSDAVEAILGQFSASRTVVQKTLSGDSTINPALGRLVLQCLCPALHSLLTDGL
KPHQSDLIAGRRPNSAWGLVQASTRPGPKTQILFNLQVRVSELPQLRHSKQRFNAFLLGL
LNTKFLDFWLSHLHSCTDVLETYYQPASFMRLSLTACRPLFEELLLVLQPLSLLTFNLDL
LFQHHRLEPDCHSPDMPSPPCQETGFQLRSQSKSRYIESLSAFNYGSSNPQTARGTPSPQ
AHPKNQAVESTDGGAERQNLPGPLGHTSPQLLWVQEKEIGALPPPDLEEDGFVQQAGQVP
WGLGRLFGASKSPSSPQGHTPPSRRPSQWLAPGVSALTRMVSSELRSLNKEVLGNPRFLQ
SHTSVRTLCDHAGTGSELTFCKGEELVVLGGVDQDWIRCRQGDREGLVPIGYTSLIM
Download sequence
Identical sequences H3BZY5
ENSTNIP00000021483 99883.ENSTNIP00000001551 ENSTNIP00000001551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]