SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001604 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001604
Domain Number 1 Region: 32-231
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.63e-52
Family Ecto-ART 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001604   Gene: ENSTNIG00000014133   Transcript: ENSTNIT00000003880
Sequence length 232
Comment pep:known_by_projection chromosome:TETRAODON8:18:1496536:1498753:-1 gene:ENSTNIG00000014133 transcript:ENSTNIT00000003880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLLYRDPFLLLWWPQEPPQASAEPAAESQVTMDMAPNAVDDMYNGCKEEMKTRVEKEF
LPNEKSTNSQFRQAWEEAEQVYNTKWKRETVMAKEQFMAIYVYNFGRRQICQDIKTAIQT
QHCNYKTTFSYHSMTFFLTDALQSLNAQGPAKGRCFVVYRRVDQYFSQSVLGKEIRFGYF
TATTLRGYNAMEKKGGKSCFKIETCHGADISMFGNPDTEALIPPYEVFNVTA
Download sequence
Identical sequences H3C038
ENSTNIP00000001604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]