SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001646 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001646
Domain Number 1 Region: 479-628
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-40
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily RING/U-box 2.78e-16
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 143-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000519
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001646   Gene: ENSTNIG00000000714   Transcript: ENSTNIT00000000041
Sequence length 633
Comment pep:novel chromosome:TETRAODON8:Un_random:1940556:1943866:-1 gene:ENSTNIG00000000714 transcript:ENSTNIT00000000041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNPVKPLATELSCPICFQLFSDPVVLPCGHNYCRTCIWMTACSADQSDQTPLCCPECREK
IRDVDSLQKNFKLCNIVEGFRAVNAQFEGHFQTKPEQTEVFCDQCVDEPSLAVRSCLNCE
VSLCSRHFQKHQEKETFRLHSLVEPLSELGKKNCVIHHRPLEYFCSNDMNLLCATCFIEG
HHQNHDILTFSAAEEEMRRALQMRSQVVLVFGVLTKLKKKNIDVSVTVTFVYNQLKRPWE
HNLLVQMSNKFIVLLQMTESLLQNMAEEQGASDVIGDKTVKKATSLIDSIAARVERIHIK
PHRDEFFFLLQSAHIFNLQAKPFYLFSFLTVGLILLCRSPRTSLKHKNTWYRERLHEVLE
EERSHCRKSWQLTLSFLEQQQHYLTDAHKMAHANAHREGHDQQVRPSRGWHSGAGVSTVP
SHQDVSGFESHAEVSILFSNARTHIHTNTKNFTFLKTFLLHPQASLKTQDFRSEMTHLLR
TVKYTHNKQLYPEHPERFTSAPQILCSKGFSGGEHVWVVDIGPNTMWSMGLCYKSIPRRG
DHSRLGHNSVSWRLQWKNSKLTVCQSSCNVALREVKTHPQRVEIALDYEGGTLMFHSTGG
HREHLYTFRAVFREPVYPAFSIHSNTTESWISL
Download sequence
Identical sequences H3C080
99883.ENSTNIP00000001646 ENSTNIP00000001646 ENSTNIP00000001646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]