SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001668 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001668
Domain Number 1 Region: 16-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.56e-94
Family Ankyrin repeat 0.00000634
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001668
Domain Number - Region: 1165-1213
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000523
Family SAM (sterile alpha motif) domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001668   Gene: ENSTNIG00000017309   Transcript: ENSTNIT00000001166
Sequence length 1561
Comment pep:known_by_projection chromosome:TETRAODON8:10:6415367:6441843:1 gene:ENSTNIG00000017309 transcript:ENSTNIT00000001166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVAVQSLFTFVEEDNLAAVKAHLDKFRDVDSRSDNGQTPLMVAAEQGNLEITQELIRR
GANVNLDDVDCWTALISAAKEGHIEVVKELLENSANLEHRDMGGWTLMWAAYKGRTDVAD
LLLDKGANPNITGQQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARK
GHYESVMHLLSNGADVDQEGANSMTALIVAVKGGYTDVVKELLKRNPNVNVTDKDGNTAL
AIAAKEGHVEIVQDLLDAGSYVNIPDRSGETMLIGAVRGGHVEIVRALLNKYADIDIRGQ
DGKTALYWAVEKGNVTMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAK
VSAVDKKGDTALHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILT
QIFGAKHLSPSESDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLE
DEMKTFAGQQIEPLFQFSWLVVFLTLLVCGSVSLVLGFTVDHKLAIAVSLSLLGLLYIFF
VLVYFGSRRERESWNWAWTISTRLARQIGYLELLLKLMFVNPPELPEQTTRALPVRFLFT
DYNRLSSVGGETSMAEMIATLSDACEREFGFMAARLFRVFKNDEVQGKKWKKTCCVPSFI
LFALTLGCLITGMALLAIFKVDPGNLTVNAVLIAMASVVGLALLLNCRTWWQVADSVFNS
QRKRLHSAANNLHRLKSEGFMKVLKQEVELISKMAKTIDGFTQNQTRMAIIIDGLDACEQ
DKVLQMLDTVRVLFSKGPFISIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHLP
VFLNSRGLSTAKKLCMVTPTNGEPLPSDGKGWHEDSERKMSLTSLGQEQFKFGSKNALNR
RDTYRRRQMQRTITRQMSFDLTKLLVSEDWFSDISPQTMRRLLNIVSITGRLLRANHIVF
NWDRLASWIHLTEEWPYRTSWIILFLEETDGVSDQITLKTLYERISKNIPMTKDVEPLLE
IDGDIRSFEVFLSSRMPVLTARDVEMFLPCTVNLDPKLREIIADVRAAREQINLGGVTYP
TLPLQDAGPRPQSMYGQASVACSPTVAFARPLPPQPHSSYFSGMTGPQHPFYNRITVPKI
QPAVLLSTMNTDAVCELVKQIDGIDTAMLPQYTAIIKKANVNGRVLAQCNLDDLKKEMEM
NFGDWQLFRNTVMEQRHAEAQAVILDESRAASEQGSVTHHAEPKRRSGAIQQDAAAFSLN
LSFEELSGAGLEEPPRPSNNSQWTVANLRTSSMSSLNSQESSNDICRLTDKQQAEYRDAY
REYISQMSQLEMAGSGADRPHPGQFIQAGSSEDNSVSGPTERSQAKDGADQDGRKSFTKR
GSKAGDVPDFPSGADSQLLDTIREEDENHSASSRTPGTKKKGVGPLYQNLLNDEESGPEE
ADTTTPLLHKEASHSSFQQDELPSKPGFFFEISLDKKDSSDSGMRSSNSSSDRSLGEAEG
DGEKGATKRSIELELEGLVKKRGLLPSSLSGLPDATVARMSICSEAPSEVSLMASSPEEG
W
Download sequence
Identical sequences H3C0A2
ENSTNIP00000001668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]