SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001675 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001675
Domain Number 1 Region: 1297-1331,1413-1576
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000288
Family NHL repeat 0.0088
Further Details:      
 
Domain Number 2 Region: 704-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000607
Family EGF-type module 0.052
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001675
Domain Number - Region: 834-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000241
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 804-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 737-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 670-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00481
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 863-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0474
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 771-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0984
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001675   Gene: ENSTNIG00000019040   Transcript: ENSTNIT00000001854
Sequence length 2823
Comment pep:known_by_projection chromosome:TETRAODON8:16:5682465:5751760:-1 gene:ENSTNIG00000019040 transcript:ENSTNIT00000001854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKERRPYRSLTARQDTEHRYTSSSADSEDGKANPKSYSSSETLKAFDHDSRMAYGSRV
KEMVHHEVDEFSRQGVDFSLRNLGFGEALPSHVATYRSDMGLPHRDYSVSAGSDPDTETD
GIMSPEHAVRLWGRSNTKSGRSSCLSSRANSNLTLTDTEHENTENGPPLHCSSASSSPVE
QLPYPPPSIAANESQGGLLGNSAAQPAQDSDSEDEFGPNSFLVKTGSGNLYTPATAAAEE
GAFQNHSRLRTPPLPLSHSHSPSHQHHAASINSLNRSNYTQRSNPSPAPTDSSVPPEGPA
SQDSVSVQDNWLLNSNIPLETRNIAKQSFLETLQDNLIEMDILASSGRDASYNDGQFLFK
PGGTSPMYCTTSPGYPLTSSTVYSPPPRPLPRNTFSRPAFSLKKPYKHCNWKCAALSAIL
ISVMLLFLLAYFIAMHLFGLNWHLQPVQRQMYQLSEDNTSGLPFPTDLSVSPVGNTGLVI
PERRGKDDSKLDSLFPDDSYIDMGEIDVGRKVTQQIPPGVFWRSQVFIDHPMYVKFNVSL
SKDALVGIYGRRGLPPSHTQQFDFVELLDGRRLLVQDIRGVEGPAAMQRGLIPITTHDTG
FIQYMDSGIWHLAIYNDGKETETVSFLTTATDSIDDCPSNCFMNGDCIAGKCHCFLGFKG
PDCGRAACPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDIACSNHGTCIVGTCICN
PGYKGENCEEVDCMDPTCSGRGVCVQGECHCFVGWGGSGCESPRASCMDQCSGHGAFLAD
TGTCSCDPNWTGHDCSTEICAADCGGHGVCVSGSCRCDDGWMGSGCDQRACHPRCNEHGT
CKDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLGNNGWYCVCQLGWRGTGCDTSMETAC
TDVKDNDGDGLVDCMDPDCCLQATCHTTALCVGSPDPLDIIQETQLSSTQSKLQTFYERV
RFLVGRDSTHVIPGVNPFDGNLVHTCIIVTQVSSLKHTKLNVANSHALNYLSDPTAGFAL
WGLCSSFDLVTNGGIAVALHFERAPFITQEHTLWLPWGRFFVMDTIVMRHEENDIPSCDV
SSFSRPSPLVSPASLTAFAGSCSERRSVVPEIQEEESANTQESDMKFSYLSSRTAGYKSL
LRVTLTHSTIPFNLMKVHLMVAVEGRLFRKWFPAAPNLSYDFVWDKADVYSQKVYGLSEV
FVSVGFEYESCPDFILWEKRAAVLQGYETTASKLGGWTVDKHHALNIQSGILHMGNGENV
FISQQPPVIGSVMGNGRRRSISCPSCNGLADGNKLLAPVALACGSDGSLYVGDFNYVRRI
FTTGNVTSVLELRTLSADGPAHRFEPTEKHISDWRHLNVHQSWQNCTVRLTLAIKSVSKM
LGMTSGVLLYCRAYNSHMCLPLNKKSHCVELTKYLLLSITVDKYGVIFFVDGTMIRRIDQ
NGIISTLLGFNDLTSARPLSCDAVMDISQVRLEWPTDLAVSPLDNSLYVLDNNVVLQISE
NHQVRIVAGRPIHCQVPGIDHFIMSKVAIHATLESANALAVSHTGILYIAESDEKKINRV
RQVSTNGEIFLVAGAPSGCDCGQELAVMTYHGSSGLLATKTNENGWTTFYESPSPVFELE
LHQTQQRGFNSDLYLLGLLSVLAIVSEVSGELHLFVVPAKKAWEVIPSTEGSNYNALLSE
MTDEGASIYHCSANCPVHFFTHNKKYQTFYMFKDSRAKCLAYSGIPASFTHFHSGTLAVK
NIRGIGSFVMYDSYGRLTNVTYPTGQVSSYRTDADSSVRIQTEGSNKENITVTTNLSASG
TFYTLMQDQVRNSYFIGLDGSLRLVLANGMEVSLHTEPHLLAGTIIPTVSKRNITLAIDN
GLNLVEWRQRKEQARGQVTVYGRRLRVHNRNLLSLDFDRITRTEKVYDDHRKFTLRIHYD
HAGRPTLWAPSSRLNGVNVTYSPGGNVAGIQRGTMSVRMEYDQTGRITSQIFADGKSWTY
TYLEKSMVLLLYSQRQYIFEFDKNDRLSSVTMPNVARHTLETSRSIGYYRTTYQPPEGNA
SVLQDYSEEGQLLQTTYLGTGRRVTYKYGKIAKLLEMLYDTTRIGFYYDELTGMLKTVNL
QSEGFTCTVRYRQIGPLIDRQIFRFSEEGMVNARLDYVYDNSFRVTSMQAVINETPLPID
LYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRVKEVQYEIFRSLMYWM
MVQYDNMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLL
SPGNSARLTPLRYDNRDRITRLGDVQYRMDEDGFLKQRGNDYFEYNSAGLLVRVYNKVSG
WSIQYRYDGLGRRVSSRSSIGHHLQFFYADLSSPTRITHMYNHSSSEIASLYYDLQGHLF
AMELSSGDEFYVACDNIGTPLAVFSGAGIMIKQILHTAFGEVYLDTNPSFQLIIGYQGGL
YEPLSRLVHMGKRDYDVLAGRWTTPNLEIWKRLNSKHIAPFNMYMFKNNNPLSNNEEIKC
YMTDVNSWLVTFGFQLYNVIPGYHKPNTESMEPSYELVRTQIKTQEWDSTKSLLGVQCEV
QRQLKAFVKLERFGQIYGAKSAGCPQTETKHIFATMGSIFGKGVKFAIREGRVSTDIISL
ANEDGRRMAAVLNDAFYLEHLHFTVAGMDTHYFVKMGPVEGDLSLIGMTVGQRTLETGVN
VTVSQVNAVLNGRTRRITDIQLQYGTLYLNTRYGSSVDEEKARILEMARQRAVTQAWARE
RQRLRDGEEGSRTWTEGEKQQLLGSGKVQGYDGYYVVSVDQYPELADSVNNIHFMRQTEM
GRR
Download sequence
Identical sequences H3C0A9
ENSTNIP00000000318 99883.ENSTNIP00000001675 ENSTNIP00000001675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]