SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001677 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001677
Domain Number 1 Region: 432-556
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 217-340
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 114-221
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-22
Family Cadherin 0.0029
Further Details:      
 
Domain Number 4 Region: 331-436
Classification Level Classification E-value
Superfamily Cadherin-like 9.03e-22
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 546-652
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001677
Domain Number - Region: 20-87
Classification Level Classification E-value
Superfamily Cadherin-like 0.0989
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001677   Gene: ENSTNIG00000015756   Transcript: ENSTNIT00000000298
Sequence length 722
Comment pep:known_by_projection chromosome:TETRAODON8:1:4491531:4493937:1 gene:ENSTNIG00000015756 transcript:ENSTNIT00000000298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIVPFLLFLVGTEAVINLKYGINEEMKPGSVIGNVTKDALKQGFQIAPQPPYLRVISNSE
PRWVELSPAGILTTQMKIDRDVVCRQNPKCVISLEVMSNSMEICVIKVEIEDLNDNAPRF
PTNHIDIEISENASPGTRFPLEGASDPDSGIFGVQSYSITPNELFGLEIKTRGDGSKIAE
LVVQKSLDRETQSHYTYEISAEDGGDPPKIGAVQLNIKVIDSNDNNPVFDEAVYTVNVME
NSPINTIVIDLNATDPDEGTNGEIVYSFHSYVTEKTRDAFKIDPRTGIITVNGVLDYETA
QIYEIDVQAKDLGPNSIPAHCKVTVNVMDTNDNPPVISLLSLNTEMVEVSENAQRGYVIA
LVRVSDKDSGANGKVQCRLQGNVPFRLQEYESFSTILVDGRLDREQKDTYNLTIQAEDSG
MPPLRATKSLVVKVTDENDNPPHFLKPHYQEMVMENNLPGSCLLAVSAEDPDLGMNGTVS
YSIVPGEIKHMDVNTYVSINPSGRIYSMRSFDHEYTRTFDFKVLARDNGNPSLSSNATVR
IVVLDVNDNTPVMTNPPLVNGTAEVSIPRNAGVGFMVTQVKADDYDEGENGRLTYTISEG
DRAFFEIDQVNGEVRSTRMFGENAKSTYEITVVARDHGKPSLSASAYIVVYLSPDLNAQE
TIGPVNLSLIFIIALGSIAAILFVTMIFVAVKCKRDNKEIRTYNCRCVAGQLTSHCCSSS
AR
Download sequence
Identical sequences H3C0B1
ENSTNIP00000001677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]