SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001680 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001680
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily EF-hand 1.33e-27
Family Calmodulin-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001680   Gene: ENSTNIG00000000127   Transcript: ENSTNIT00000002418
Sequence length 140
Comment pep:known_by_projection chromosome:TETRAODON8:2:15849854:15851116:1 gene:ENSTNIG00000000127 transcript:ENSTNIT00000002418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYREAFGLFDRVGDNKVAYNQIADIMRAPGTPTNKEVTKMLGKPHRADMANKRVEFEGFL
PMLQTIINSPNKAGYEDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMNEAEIDALMAG
QEDENGCVNYEAFVKHIMSV
Download sequence
Identical sequences H3C0B4
ENSTNIP00000001680 99883.ENSTNIP00000001680 ENSTNIP00000001680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]