SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001708 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001708
Domain Number 1 Region: 190-428
Classification Level Classification E-value
Superfamily vWA-like 2.49e-33
Family Integrin A (or I) domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001708   Gene: ENSTNIG00000012640   Transcript: ENSTNIT00000002018
Sequence length 880
Comment pep:known_by_projection chromosome:TETRAODON8:19:949792:953729:-1 gene:ENSTNIG00000012640 transcript:ENSTNIT00000002018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDISVQSYQVESRITSRFVHTSVRSAVLNSAPRAQSIGFNVQVPKRAFITNFTMNVNGIV
FVGSVKEKTVARNLYAQARARAKAAGIVRTGSLDMETFQTEVHVPPGSNIQFELHYQEML
SRRLGLYQHTLHLQPGRLVPHFQVDVHIFEPSGISMVQTKQALAKEFNDFVSVTRSKNTA
HVVFKPPLQQQKKCPNCTETAVDGVFAVQYDVERAGNAAELQVSDGHFVQFFAPSNFPPL
RKNIVFVIDVSGSMWGVKMKQTVEAMQAILDDLTVDDSFSIVDFNHNVRCWSEDLVPGSS
VQVKDAKTYIENIKPNGGTNINEALMRAVQMLVRASHQGLVDPRSVSMIILVSDGEPHRG
GEIKLSAIQKNVKRAMREEFSLFSLGIGFDVDFDFLERIATENRGVAQRIYANQDTADQL
RSFYRQVAAPLLRRIDVQFPEDSVSDVTQNRFDKYFEGSELVVAGKVLPSESNTLTSFIT
ASAARLDVSLQTDADAAELDAELARQEHSFTGFARQLWAYVTVKQLLSDRSLAPSAARKR
KITQRIMAIALEHQFVTPLTALLVESEDASERLLADAPKDPKHGCCTGQVCACRTGPGRR
PPPWVQMTTPAPPSQVEGGQVEQTLPGRVTIVDNDPHFIVHLPRGNMDVCFNVNSRPGDI
LNLVSDSGTGLTVNGQLIGSKKMRANKLDTYFGTISIFYRPGGVGVTVGTAGVQVTDGRS
NRSLAWAATSAITRDSVRVSVVKDSHVSVTVGANIQVMVLLHRVWKKHPVNVDFLGIYVA
SENQYSPLVHGLIGQFSREPEVRIHHIQPGVDPLKKEAVMEVKGNRLHVTSRGWQKDYRR
DRRSGSNVYCWFVHNSGKGFIDGHYTDYIVPELRSFLRRP
Download sequence
Identical sequences H3C0E2
ENSTNIP00000001708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]