SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001743 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001743
Domain Number 1 Region: 191-350
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-22
Family Protein kinases, catalytic subunit 0.0028
Further Details:      
 
Domain Number 2 Region: 25-127
Classification Level Classification E-value
Superfamily PX domain 1.01e-20
Family PX domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001743   Gene: ENSTNIG00000006730   Transcript: ENSTNIT00000002817
Sequence length 572
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:17007922:17017459:-1 gene:ENSTNIG00000006730 transcript:ENSTNIT00000002817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYMEKPLSGRVLLDDTVPLTAVIEASQNAQSHTEYIIRVQRGVSAENSWQVIRRYSDFD
LLNNSLMVCGISLLLPPKKLIGNMDRDFIAEQRGLQAYLDSVTQHPLLSSSLPVKKFLDP
NSYSANYTEIALQQVSMFFRSDLKWEVLEPLRDLGWRIRKKYFLVKNKEQPKERYLLSWV
DLGPHMFLSDKDLQSAMKWLTSITVPYLCPLLFSSVSESSAMLIRPFSETGSLRDHICKV
KPKECYLKKYCNPKKREGLPLQDIKKYGRQILEGLKVLHEAGLFYGHLHASNVIVDGDVC
RLVDVENGLLGVPSFLRPAFTQHRKINTMESVDVFSFGVLLYEMTYGRPADSVPVNHYPA
APSAAVAVSVLQSILSAEACKGTMPTVAELLQTPFFRDVHLQPSEKPIKISNRLKEALKA
ARQSNERRLQEEQKAFTKHRRLTRAQSHHCSDEERKRRKILARKKSRRSACDTEEDVSIR
NNKLFHLLSGSGASSPPTCPSSPTPSSTTGLNSALGLPPNEGAQSDPPPAPPLLSSPDGV
AGSRSALLSSIQTFRKGKLKKTETTDRSNPVI
Download sequence
Identical sequences H3C0H7
ENSTNIP00000001743 99883.ENSTNIP00000001743 ENSTNIP00000001743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]