SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001754 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001754
Domain Number 1 Region: 131-378
Classification Level Classification E-value
Superfamily vWA-like 1.22e-82
Family Integrin A (or I) domain 0.0000000102
Further Details:      
 
Domain Number 2 Region: 374-463
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-29
Family Integrin domains 0.000026
Further Details:      
 
Domain Number 3 Region: 629-713
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.15e-23
Family Integrin beta tail domain 0.0000434
Further Details:      
 
Domain Number 4 Region: 24-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000136
Family Plexin repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 587-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Integrin beta EGF-like domains 0.00072
Further Details:      
 
Domain Number 6 Region: 545-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001754
Domain Number - Region: 508-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001754   Gene: ENSTNIG00000011722   Transcript: ENSTNIT00000000199
Sequence length 785
Comment pep:known_by_projection chromosome:TETRAODON8:3:13410732:13417479:1 gene:ENSTNIG00000011722 transcript:ENSTNIT00000000199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRRPLGVLPLELLKGLGMTGSASNICTSRGVTTCQQCLAVHPSCAWCSQEDFGKGSSIS
RCDLKENLLKEGCSQAAVEFPSSTLTVDQDAPLSDKASGVADDVIQVKPQKIRVTLRQGD
AKRFTVYVKQVEDYPVDLYYLMDLSYSMKDDLSNLRTLGNKLADTMGRTTSKLRMGFGAF
VDKTVSPYMYTYPPLAVENPCYKDQVKCQAQFGFKHVLSLTEQVGRFTEEVEKQQVSKNR
DAPEGGFDAVMQAVVCKENVGWRADASHLLVFTTDAKTHIALDGRVAGIVQPNDGKCHLD
YSNNYNQSTILDYPSLALMTEKMSENNINLIFAVTNYVVPLYKEYSKLIPGTTVGILSDD
SGNVIELIKEAYEKIRSKVQLELLGVPDELNLSFNATCQSGEVVPGLKSCSGLKIGDTVS
FSIEAQLRRCPKDKSRTFTIKPLGFKDSLEITVDFACSCNCEAGAQANSSLCSHGNGTYE
CGCQCHSGRLGPRCECSVEDYSPSDDANCIDKADGPVCSGRGDCLCGQCSCHGNDFGQVW
GKYCQCDDFNCLRFRGELCSNHGKCSCGSCVCDAGWKGENCNCSTRTDTCMSSIGLLCSG
RGNCECGVCQCTQPGAYGATCEKCPTCPDSCTIKKHCVECQHFKRGQYIEDNSCSRICKD
EIKVVDEIGVRDNNAVNCSYKDEDDCLVHFQYYEDESGKSILSVVKMLECPEGPNILVVL
LAVAGAILLLGLVGLLIWKLVITIHDRKEFAKFEEERARAKWDTGNNPLYKGATSTFTNI
AYKGN
Download sequence
Identical sequences H3C0I8
ENSTNIP00000001754 ENSTNIP00000004009 99883.ENSTNIP00000001754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]