SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001785 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001785
Domain Number 1 Region: 1-340
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.13e-91
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 2 Region: 669-1015
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.97e-64
Family Hect, E3 ligase catalytic domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001785   Gene: ENSTNIG00000010295   Transcript: ENSTNIT00000000546
Sequence length 1022
Comment pep:known_by_projection chromosome:TETRAODON8:10:10010416:10018704:1 gene:ENSTNIG00000010295 transcript:ENSTNIT00000000546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYCWGDSSSGQFGPRTATRPVSWTVPRTVIDISCGDRHILFLTEDGCVLSCGNNSDGQLG
RKKKHKNKAPGCVEGLGHVVQISCGCNHSLAVDASGHVFSWGAAEDGQLGLNPNPLSGRP
SMVTIPLRVPVVQVACGKSHSVALTTGGDVLSWGSNSYGQLGLGTEVPSQETPALVAGLV
GVPVSQISAGATHTMFLTLAGLVYCCGANQSGQLGLNRVDEKGRFDVCMVPRLRPLGVCF
ISCGEAHTAALTMNGEVFTFGEGCHGQLGHGSTADELRPRLVESVGRHASQISCGSYHTL
VLGSSGHIWAFGSGNKGQIGTGHQDDVLTPTMVELPWTTDDAAAAPTGLCSARVLAVGDL
KISAGWNTNFAYVSTVQNPKRGQVTGRLNEARLQRWLRTTTPNTETENSNSEIKSVFFTS
SSLVSSFTKAGISSIVFQKCFYKTGRSFSGPSLEAGALTVDLEAVCRAFDQLLAIPWIKK
LFKTDTLMLSRTALNSPEIILILLACPLFQEETHVCHVWKIALVISDLKEKCLKALKDCW
SSLMPPMLLKHILVFKNTLGFMLKNSLHVPVGKHVLEILKLLFQVGVICLLCCFLLSSVP
LVLRGHFALLRCVCDERNWSMDIFIHFSFRLTRIKSPYCSYPFLLPLEFKVELFKASAFI
EKVKLNLQNLFISTCMHLTLRRNHLVEDSFRQLAAADHCAFRKKLLVIFTDNRKVTNVNI
SDFFLHVFGHLIDPKSGMFMYNEDETLAWFPPKPKKKARIYFLFGVLCGLAFFHQNMVHL
PFPLVLFKKLLRVKPSLDDLREFDPVRAESLRYLLEDCSPEEVESLDATFTVETWGGETV
ELDPSESGKPVTASNSRQQFVAAFVNHAFNASVESVFEEFKHKGSHHLLSLKIKVQSSKI
QLTSKQIISEHIKNTVYEEPYDANHPNIVTFWEAFDRLSAEEKKHFLWFLTGSERVPLGG
MKSIKMAVATLANATELALPESLTCYHLLMLPVYDSDSPDSISLMQSRLLQAIYNKSGFR
RE
Download sequence
Identical sequences H3C0L9
ENSTNIP00000001785 99883.ENSTNIP00000001785 ENSTNIP00000013198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]