SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001850 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001850
Domain Number 1 Region: 213-336
Classification Level Classification E-value
Superfamily Cadherin-like 3e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 425-550
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-28
Family Cadherin 0.0049
Further Details:      
 
Domain Number 3 Region: 110-217
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-23
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 328-430
Classification Level Classification E-value
Superfamily Cadherin-like 7.72e-21
Family Cadherin 0.0066
Further Details:      
 
Domain Number 5 Region: 541-649
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-18
Family Cadherin 0.0045
Further Details:      
 
Domain Number 6 Region: 12-108
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000157
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001850   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000004179
Sequence length 974
Comment pep:known_by_projection chromosome:TETRAODON8:1:4162:16061:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000004179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIIVFSGLTDAQIRYSIPEELENGAPVGDIIRDLGLDPRKLSTRRIRVTSDGTHRRYFA
INHKTGKLTVSDRIDRETVCEFSTCSLNLEVVLENPLDVHNVEVEILDVNDNAPQFPRDE
YQLEVSESALTGSRFHIEGAQDADDGSNAVKQYRLSRNDHLTLDSVKQFTNNKHIELILK
KPFDRELMPSHQLILTAIDGGTPQRSGTARINVRVLDANDNAPVFGSLTYKVKLSENSVK
GSLVIKLNATDIDEGSNGNVFYSFSSYTPERVRQMFSLDTDTGEIRVKNNIDYEETNSYE
MYIQAMDKGPAPVAAHCKVVVDILDENDNVPEIVLSSLSSPVREDARADTVVALISVNDR
DSGLNKQVTLEIGPNLPFTIKSFRNHYTVVTSAFLDRETIRSYNVTVSAVDGGTPPLSSQ
MSFMVEVADVNDNPPRFEQTSYTVYVTENNARGASLCIVKATDADAAENARITYTVISDN
NYGIHVASYVSIKPNTGEAYALRAFDFEKLREFHFQVKAQDNGVPPLSRVVTVYVYIMDQ
NDHAPRIFYPPANGSHATEMLMKNAEAGVLVSKVVAWDGDAGQNAWLMYTLKQTSTDLDL
FKVHEYTGEIRTTRHVIEDNSTSFILTVLVRDHGLPPLSSTATLHVHVMEPAPKITPDPK
RIIRPNSPLKFSKVTIYLIIALCATTFVFLVTVFVLAIVRCHAYCTQPGSCSPCCVSKKN
VPEGGIPQASANVALRRDLKVEPHYIEVRRNGSMTKTYCYKTCLTATSGSDTFMFYNTGR
PHSGTWGSGYVTSHSGQSQIFVRRLSMPDATAIQPKMPSADWRYSASLRAGGVMQSSVHM
EESSVMQGAQGVLVQNWPTASSAAAENAEGGEVSPPMGAGVDSNSWHFRYGPGGPGAPPQ
HLKPGEVPPEAFIIPGSPAIISIRQNQGGEDDKSDFITFGKKEEDNMKSILSEGRKFVRE
KKDMRQITKKKKDA
Download sequence
Identical sequences H3C0T4
ENSTNIP00000001850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]