SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001864 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001864
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily EF-hand 1.58e-52
Family EF-hand modules in multidomain proteins 0.00000255
Further Details:      
 
Domain Number 2 Region: 142-238
Classification Level Classification E-value
Superfamily EF-hand 2.18e-39
Family EF-hand modules in multidomain proteins 0.0000047
Further Details:      
 
Domain Number 3 Region: 218-307
Classification Level Classification E-value
Superfamily RING/U-box 2.47e-19
Family ZZ domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001864
Domain Number - Region: 425-520
Classification Level Classification E-value
Superfamily Prefoldin 0.00238
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001864   Gene: ENSTNIG00000013288   Transcript: ENSTNIT00000003385
Sequence length 594
Comment pep:known_by_projection chromosome:TETRAODON8:3:3716519:3730576:1 gene:ENSTNIG00000013288 transcript:ENSTNIT00000003385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REEISPSHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSMPL
ACEVFEQHGLKQNEQLLDISQLVACLTSLYQRLEQSHAHLVNVPLCVDMCLNWLLNVYDT
GRTGKIRTLSFKTGIVSLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQL
GEVASFGGSNIEPSVRSCFQFANNKPELEAAMFLDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIIGFSRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGE
DVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMETPGSSPQLSHDDTHTRIEHY
ANRLAEMENRNGSYLNDSISPNESIDDEHMLIQHYCQSLNQGSPLSQPRSPAQILISMET
EEKGELERVLNDLEQENRKLQSEYDRLKKAHDRKGLSPLPSPPEMLPVSPQSARDAELIA
EAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQTDSKVNGTALSSPSTSQRSDS
SLPVLRVAASQTTDTMGSDDELSSPSQDASGLEEVMEQLNNSFPHSQGTEQRAL
Download sequence
Identical sequences H3C0U8
ENSTNIP00000001864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]