SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001888 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001888
Domain Number 1 Region: 162-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.23e-29
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001888   Gene: ENSTNIG00000016861   Transcript: ENSTNIT00000000163
Sequence length 448
Comment pep:known_by_projection chromosome:TETRAODON8:1:9318883:9326808:1 gene:ENSTNIG00000016861 transcript:ENSTNIT00000000163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRQRCRSKKYQTGEYITDRDSHQNSCSLGSANAYCADITSSPQQEEKHERRKRRNFPPKH
SKHLGVKDEIKNIPQHLCSGVSQDSADKPSGKRKFKSKHLCDNGDQKDDRDVKRTSSPPP
APKSLQSPPSGKKGSSGRSSNADSPPKKPIPPEVRRLIVNKNAGETLLQRAARLGYQDVV
LYCLEKDVSEVNRRDNAGYTALHEASSRGWTQIVQMLLKHGADVNCSAQDGTRPLHDAVA
SDNLPIVWLLLNHGADPTLATYSGQTPVKLAQSPTMKTFLTEYFTDLEGRKEQDPSLHWD
FYSSSLFAETDQEACWDFLLSDESQEMEEKDTGKPEDTDKDCLVFEFSSEPLLPCYHIQV
SLTQGFCNWFLLTDVLKRLKMSARIFRARYPHLEVVSLLRTELWEQVLVSQVSTALGSPH
KELIELVRCVPELQRLLGSSIHILSCES
Download sequence
Identical sequences H3C0X2
ENSTNIP00000001888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]