SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001892 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001892
Domain Number 1 Region: 289-433
Classification Level Classification E-value
Superfamily PH domain-like 4e-39
Family Third domain of FERM 0.00000747
Further Details:      
 
Domain Number 2 Region: 185-290
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-33
Family Second domain of FERM 0.00000284
Further Details:      
 
Domain Number 3 Region: 105-184
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.92e-22
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001892   Gene: ENSTNIG00000003171   Transcript: ENSTNIT00000001449
Sequence length 754
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:57114702:57122180:-1 gene:ENSTNIG00000003171 transcript:ENSTNIT00000001449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRGLSRLLSSLLKRRSQCGSDAGDQQDQEQTKAPIADPEPELRAEGELAQDQRSVSSAEA
QVHQQNVHTHPLHSETEVLVLRSHRTPSVCAGPGARAPRQPKSLQIRVTLLDNSVYECEL
DKHCKGLELFMKVCDHLNLLEKDYYGLAVWESPVRKTWMDLTKEIRRQVQGAVLNLTFNV
KFYPPDPAQLSEDITRYYLCLQLRQDILQGHLPCSFVTLALLGSYALQSELGEYDPDLHG
ADYAKDMKMVPGQTKELEDKMMELHQTYRSMSPAQADLMFLENAKKLSMYGVDLHPAKDL
DGVDIMLGVCSSGLMVYKEKLRINRFPWPKVLKVSYKRSSFFIKIRPSEAELYESAIGFK
LPTYKAAKKLWKVCVEHHAFFRLTATEATHTPRKFLALGSKFRYSGRTQAQSRQASSLID
RPAPLFQRSSSKRNTHSLDGGPPPAPSRTPRPFSAPVMSPLSPGEPSPSPVPSDPRGPAP
REQRCADRKAEGPESTRGHDLQPQPTPETKICPSGSAPRFQEQSFSWSDNKAKMEVTRTR
KKRVKKPEGETIYIKHSNLMLEDLEKTQTQTLRHHNSISELKRSFMESLPEARPSEWDKR
LSGSSPFRTVSTVSAGEQSPVLKTQTITISDVTEALRGVVVYRDAPLGHSETKTGSYESA
QPDECPVEKDAGALLSAQTITSETVSTTTTTQITKTVKGGISETRIEKRIVITGDTEIDH
DKALAQAIKEAKEQHPDMSVTRVVVHQETEITPE
Download sequence
Identical sequences H3C0X6
ENSTNIP00000001892 99883.ENSTNIP00000001892 ENSTNIP00000001892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]