SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001894 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001894
Domain Number 1 Region: 22-192
Classification Level Classification E-value
Superfamily vWA-like 1.67e-44
Family Integrin A (or I) domain 0.00055
Further Details:      
 
Domain Number 2 Region: 504-688
Classification Level Classification E-value
Superfamily vWA-like 2.54e-44
Family Integrin A (or I) domain 0.00072
Further Details:      
 
Domain Number 3 Region: 276-477
Classification Level Classification E-value
Superfamily vWA-like 4.45e-30
Family Integrin A (or I) domain 0.0018
Further Details:      
 
Domain Number 4 Region: 245-309,690-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001894   Gene: ENSTNIG00000018899   Transcript: ENSTNIT00000001914
Sequence length 733
Comment pep:known_by_projection chromosome:TETRAODON8:2:8637266:8643106:-1 gene:ENSTNIG00000018899 transcript:ENSTNIT00000001914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEIQTSHENIKKITAAGQLMQCSAAMDILFLMDGSYSVGKGSFERSKHYALKLCQALDI
RPDKVRVGLIQFGSAPRLEFALDLHATKQELMRHMKKISYRGGSTQTGLALKYVLRKGLP
GGRNSSDAAQIVIVLSDGKSQGNVMQAAAQLKETGVVLFAVGLRYPRWEELHALASEPVE
NHVFFAEHFYDAVNGLYTTLATFSVCSATPQGCHMRSFPCERKTLETVKELLGNFMCWKG
TKGYSPYTSLCPHYRYNKVYKRHQTVCHRTICPDPCDSQPCLNSGTCVSEGSEGYRCVCP
PGYGGDPHCAPALSLDCSVDLLFLVEGSSAMTLEGFLRLKSFLKRFLQTVIGSDSPSKVG
LAVFGSDTRVEAQVGQFRGDPKSLLKAVEALQQYGGEARTGQALRYVTRHGFVSTPVFAD
VSDDLPRVVVLMTSTPAVDEVVEASRYARDREIFLIGMGPHYLKSQLNTITGNPQRTVTY
SSSEFGIKIPELKAKICSVDTQGCLGQALDLVFALDASDGVGRDNFLTLCDFVRSLSVQF
DINRDVAQLALVAYSRRATTVFNLDTHDSGSAVLTAIGEASYMGGVASTGTALLHVHSDV
LTVDKGARLGVNKAVVVVTDGSGGTDAVVPAQKLRDNGVSVFVVGIGDMQREKLLQIAGS
EEHLILVPSYEDLKYFEDVLVQMLCSEAKMPVNLCKPNPCMHDGVCTLSGASFRCQCRGY
EGPQCETNFSFSP
Download sequence
Identical sequences H3C0X8
ENSTNIP00000001894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]