SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001903 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001903
Domain Number 1 Region: 45-92
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 2.88e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 246-295
Classification Level Classification E-value
Superfamily UBA-like 0.00000000391
Family UBA domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001903   Gene: ENSTNIG00000015486   Transcript: ENSTNIT00000001181
Sequence length 438
Comment pep:known_by_projection chromosome:TETRAODON8:1:15569066:15570667:-1 gene:ENSTNIG00000015486 transcript:ENSTNIT00000001181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRPELPTASSASQVHPGPSIPVSMAGNLLRGPPLLLRAADKYPRTPKCARCRNHGVVS
ALKGHKRYCRWKDCMCAKCTLIAERQGVMAAQVALRRHRAQEENEVRELQLLYGTAERWP
LAAANGIIPPRPNYEVFGSVSSETNSGEPSSAARPSDPHQPAVGSSTPQQSAGKSAPAEG
DSAPAMSPPDGRHAGSGSENGDSESFINSPVSKPLKDGGETPGSVSSIGSDSGSETDKEE
QEASPSPAASRHMNAIDILTRVFPSHKRSVLELVLQGCGKDVVQAIEQILNNSGAQGPDE
TWTAERMLHGAQQPPPPPATSTTTAPTRPMLPGAMTLSNRSAFSPLQPNAPHFGADPGAY
PLGTHLGLNPRLAYSAHGRGLAFMAPYSTTGLMPTLGFRPPMDYAFSDLIRDRTMLHKEQ
GYTGGLYGPLVNNTTEKQ
Download sequence
Identical sequences H3C0Y7
99883.ENSTNIP00000001903 ENSTNIP00000001903 ENSTNIP00000001903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]