SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001948 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001948
Domain Number 1 Region: 874-1183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.43e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000131
Further Details:      
 
Domain Number 2 Region: 1143-1442
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000129
Further Details:      
 
Domain Number 3 Region: 359-546
Classification Level Classification E-value
Superfamily Fibronectin type III 6.52e-25
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 2-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-22
Family MAM domain 0.0000402
Further Details:      
 
Domain Number 5 Region: 289-383
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000122
Family Fibronectin type III 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001948   Gene: ENSTNIG00000010747   Transcript: ENSTNIT00000000429
Sequence length 1444
Comment pep:known_by_projection chromosome:TETRAODON8:14:4487479:4523144:-1 gene:ENSTNIG00000010747 transcript:ENSTNIT00000000429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSCSFDEGFSTCNYQHDLNGDFDWTHINTKAVPYVSPDLPQALFEYVKDRNMSQGKASS
LLLNQVCARSDAHILCASVLIIKSDGSGQGVQSNVMVKVNRAQPANPIWNVTSFTGKNWL
KAELAVSTFWPNEYQVLFEASVSKSKAGFIAIDNVQVLSYPCGPLPSLPLHLLSPEISLC
CKRKKITPHVQLWSEEVFEKELVLALHCDSIHSSSCSSARTLVCEVTSQDQDLFRCVTQS
ELGSGVSNFAHLFVKGPDKPFTIDDLFCFSVSYISNWKIGQTIIKLGSIIFLHVAYRMTS
GSWTETHAVNTVTYKLWHLDPDTEYEIRVLLTRPGEGGTGKPGPPLITRTKCAEPMRTPK
RLKIARTMSRLIAVDWESLGYNITRCHTFNVTICYQYTTANKIFLFNKFFSTAPRHLVEN
LPPYTNVSLKLILINPEGRKESDDTIVQTDEDVPGPVPSQSLRAFPSEDSILLYWKKPSE
PNGIIIQYEISYCGLHSFDPSFPLDQSVLTVSLPSNATNHTFSQLHPGVTYELSIRASTS
KGFGQAVTLNITTNISAPTIEKYDGSEAFLNETETTITVLVKPAQAKGAPISNYYIVVDK
ENQQRRRRQAPSDCYTVPFSYSDASKSGSNYYFAANLCPENILEPIPFTVGDNKTYQGFW
NPPLALRKTYNIYLQAVSSTTKESKRHCLKLASKVNPWAAATHTQMQSECFEMLVGATEE
PNFVPDPAKQTNPTMKITGICLSVIVPILLVALTVFLVKKRLAHNPRRTYYSYSYYLINR
KLARKRQDVIRTTGQEMTDLGNSTDRSYAERSTLHREDPMAVTFVETHTYNNRYENHGGS
AAENSHLLDIARYHCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYESLFE
GQSASWDVAKKEQNRTKNRYGNIIAYDHSRVILQPIENDPSSDYINANYIDGYQRPSHYI
ATQGPVHETVYDFWRMVWQEQSACIVMVTNLVEVGRVKCFKYWPEDAELYGDFKVTYLET
EHLAEYVVRTFTLERRGFNEMREVKQFHFTGWPDHGVPYHATGLLSFIRRVKISNPPSAG
PIVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIHD
AILEACLCGETAISICEFKAAFYELIRIDSQTNSSHLKDEFQTLNSVTPQPQPEDCSIAL
LPRNQDKNRFMSGLPPDRCLPFLLTMDGESSNYINAALMDSYRQPAEFIVTQHPLPNTVK
DFWRLVYDYGCASLVMLNEIDLAQGCPQYWPEEGMLCYGHMQVDCISSSMDCDIISRLFR
VHNVTRPQEGYLMVRQFQYLGWAGHRDVPASKRSFLKLILQVDQWQREVEEEGEGRTIVH
CLNGGGRSGVFCASSIVCEMSKRQSVVDIFHAVKTLRNSKPNMVDTPEQYRFCYDLALEF
IESS
Download sequence
Identical sequences H3C132
99883.ENSTNIP00000001948 ENSTNIP00000000357 ENSTNIP00000001948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]